Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEY |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | POLR2H |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-80816 | Applications | Species |
---|---|---|
Shearn CT, Anderson AL, Devereux MW et al. The autophagic protein p62 is a target of reactive aldehydes in human and murine cholestatic liver disease PloS one 2022-11-15 [PMID: 36378690] (IHC-P, Mouse) | IHC-P | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for RPB8 Antibody (NBP1-80816)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.