![Western Blot: RP2 Antibody [NBP3-10108] - Western blot analysis of RP2 in Mouse Stomach lysates. Antibody dilution at 1ug/ml](http://images.novusbio.com/fullsize/RP2-Antibody-Western-Blot-NBP3-10108-img0001.jpg "Western Blot: RP2 Antibody [NBP3-10108] - Western blot analysis of RP2 in Mouse Stomach lysates. Antibody dilution at 1ug/ml")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse RP2 (NP_001277572.1). Peptide sequence EEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RP2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RP2 Antibody (NBP3-10108)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RP2 |
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Western_Blot_11365.jpg)
![Immunohistochemistry Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Immunohistochemistry_11545.jpg)
![Simple Western Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Simple_Western_20232.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")