![Western Blot: RP2 Antibody [NBP1-82549] - Analysis in human cell line BEWO.](http://images.novusbio.com/fullsize/RP2-Antibody-Western-Blot-NBP1-82549-img0004.jpg "Western Blot: RP2 Antibody [NBP1-82549] - Analysis in human cell line BEWO.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RP2 Antibody (NBP1-82549)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RP2 |
![Immunohistochemistry-Paraffin: RP2 Antibody [NBP1-82549] - Staining of human appendix shows moderate cytoplasmic positivity in lymphoid tissue and glandular cells.](http://images.novusbio.com/fullsize/RP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82549-img0003.jpg "Immunohistochemistry-Paraffin: RP2 Antibody [NBP1-82549] - Staining of human appendix shows moderate cytoplasmic positivity in lymphoid tissue and glandular cells.")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Western_Blot_11365.jpg)
![Immunohistochemistry Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Immunohistochemistry_11545.jpg)
![Simple Western Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Simple_Western_20232.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")