Home » RNF2 » RNF2 Proteins » Recombinant Human RNF2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human RNF2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: RNF2 Recombinant Protein [H00006045-P01]
SDS-Page: RNF2 Recombinant Protein [H00006045-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human RNF2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-336 of Human RNF2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
RNF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
64.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF2 GST (N-Term) Protein

  • BAP-1
  • BAP1RING finger protein 1B
  • DING
  • DINGRING finger protein BAP-1
  • EC 6.3.2
  • HIPI3
  • HIPI3RING1BE3 ubiquitin-protein ligase RING2
  • Huntingtin-interacting protein 2-interacting protein 3
  • Protein DinG
  • ring finger protein 2HIP2-interacting protein 3
  • RING1B
  • RING2
  • RING2EC 6.3.2.-
  • RNF2

Background

Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RING1 Antibody
NBP1-80830
Immunocytochemistry/ Immunofluorescence RING1 Antibody
Western Blot RING1 Antibody
Immunohistochemistry-Paraffin RING1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PRC1 Antibody -
BSA Free
NBP2-81882
Western Blot PRC1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRC1 Antibody - BSA Free
Immunohistochemistry PRC1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
UCH-L3 Antibody
NBP1-86037
Immunocytochemistry/ Immunofluorescence UCH-L3 Antibody
Immunohistochemistry-Paraffin UCH-L3 Antibody
Immunohistochemistry-Paraffin UCH-L3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
BMI-1 Antibody
(LLBmi1-1) - BSA Free
NBP1-96140
Flow Cytometry BMI-1 Antibody (LLBmi1-1) - BSA Free
Flow Cytometry BMI-1 Antibody (LLBmi1-1) - BSA Free
Immunocytochemistry/ Immunofluorescence BMI-1 Antibody (LLBmi1-1) - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
Histone H2a
Antibody
NB100-56346
Western Blot Histone H2a Antibody
Western Blot Histone H2a Antibody
Immunohistochemistry-Paraffin Histone H2a Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot ALDH9A1 Antibody
Western Blot ALDH9A1 Antibody
Immunohistochemistry-Paraffin ALDH9A1 Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot ILT6/CD85e/LILRA3 Antibody (2E9)
(6 Publications)
Species: Hu
Applications: ELISA, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/ Immunofluorescence Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
BRCA1 Antibody
(RAY) - BSA Free
NB100-598
Western Blot BRCA1 Antibody (RAY) - BSA Free
Immunocytochemistry/ Immunofluorescence BRCA1 Antibody (RAY) - BSA Free
Flow Cytometry BRCA1 Antibody (RAY) - BSA Free
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
EED Antibody
[Unconjugated]
AF5827
Western Blot EED Antibody [Unconjugated]
(5 Publications)
Species: Hu, Mu
Applications: WB
Host Cell Factor
1/HCFC1 Antibody
NB100-68209
Knockdown Validated Host Cell Factor 1/HCFC1 Antibody
Immunoprecipitation Host Cell Factor 1/HCFC1 Antibody
Western Blot Host Cell Factor 1/HCFC1 Antibody
(5 Publications)
Species: Hu
Applications: IP, KD, WB
MEL-18 Antibody
NB100-1240
Western Blot MEL-18 Antibody
Western Blot MEL-18 Antibody
(1 Publication)
Species: Hu
Applications: PEP-ELISA, WB
EZH2/KMT6 Antibody
[Unconjugated]
AF4767
Western Blot EZH2/KMT6 Antibody [Unconjugated]
Western Blot EZH2/KMT6 Antibody [Unconjugated]
Western Blot EZH2/KMT6 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: ICC, WB
Recombinant Human
RNF2 GST (N-Term) Pro ...
H00006045-P01
Recombinant Human RNF2 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for RNF2 Recombinant Protein (H00006045-P01) (0)

There are no publications for RNF2 Recombinant Protein (H00006045-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF2 Recombinant Protein (H00006045-P01) (0)

There are no reviews for RNF2 Recombinant Protein (H00006045-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF2 Recombinant Protein (H00006045-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF2 Products

Research Areas for RNF2 Recombinant Protein (H00006045-P01)

Find related products by research area.

Blogs on RNF2

There are no specific blogs for RNF2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol RNF2