![Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Analysis in human testis and liver tissues using NBP1-84416 antibody. Corresponding RBM14 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RBM14-Antibody-Immunohistochemistry-Paraffin-NBP1-84416-img0010.jpg "Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Analysis in human testis and liver tissues using NBP1-84416 antibody. Corresponding RBM14 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR |
| Predicted Species | Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RBM14 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
| Publication using NBP1-84416 | Applications | Species |
|---|---|---|
| Bajc Cesnik A, Darovic S, Prpar Mihevc S et al. Nuclear RNA foci from C9ORF72 expansion mutation form paraspeckle-like bodies J. Cell. Sci. 2019-02-11 [PMID: 30745340] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for RBM14 Antibody (NBP1-84416)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RBM14 |
![Immunocytochemistry/Immunofluorescence: RBM14 Antibody [NBP1-84416] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RBM14-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84416-img0009.jpg "Immunocytochemistry/Immunofluorescence: RBM14 Antibody [NBP1-84416] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.](http://images.novusbio.com/fullsize/RBM14-Antibody-Immunohistochemistry-Paraffin-NBP1-84416-img0013.jpg "Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.")
![Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/RBM14-Antibody-Western-Blot-NBP1-84416-img0007.jpg "Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in human cell line MOLT-4.")
![Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/RBM14-Antibody-Immunohistochemistry-Paraffin-NBP1-84416-img0011.jpg "Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RBM14-Antibody-Immunohistochemistry-Paraffin-NBP1-84416-img0012.jpg "Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/RBM14-Antibody-Immunohistochemistry-Paraffin-NBP1-84416-img0014.jpg "Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in mouse cell line NIH-3T3.](http://images.novusbio.com/fullsize/antibody/nbp1-84416_rabbit-polyclonal-rbm14-antibody-western-blot-261202495234..jpg "Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in mouse cell line NIH-3T3.")
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")