![Western Blot: RAB3IP Antibody [NBP1-92309] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/RAB3IP-Antibody-Western-Blot-NBP1-92309-img0004.jpg "Western Blot: RAB3IP Antibody [NBP1-92309] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB3IP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: RAB3IP Antibody [NBP1-92309] - Staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RAB3IP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92309-img0005.jpg "Immunocytochemistry/Immunofluorescence: RAB3IP Antibody [NBP1-92309] - Staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/RAB3IP-Antibody-Immunohistochemistry-Paraffin-NBP1-92309-img0010.jpg "Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human pancreas shows strong cytoplasmic positivity in pancreatic ductal cells.](http://images.novusbio.com/fullsize/RAB3IP-Antibody-Immunohistochemistry-Paraffin-NBP1-92309-img0006.jpg "Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human pancreas shows strong cytoplasmic positivity in pancreatic ductal cells.")
![Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human kidney shows moderate membranous and cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/RAB3IP-Antibody-Immunohistochemistry-Paraffin-NBP1-92309-img0007.jpg "Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human kidney shows moderate membranous and cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/RAB3IP-Antibody-Immunohistochemistry-Paraffin-NBP1-92309-img0008.jpg "Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/RAB3IP-Antibody-Immunohistochemistry-Paraffin-NBP1-92309-img0009.jpg "Immunohistochemistry-Paraffin: RAB3IP Antibody [NBP1-92309] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")