![Western Blot: KIAA0020 Antibody [NBP1-87296] - Analysis in control (vector only transfected HEK293T lysate) and KIAA0020 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/KIAA0020-Antibody-Western-Blot-NBP1-87296-img0009.jpg "Western Blot: KIAA0020 Antibody [NBP1-87296] - Analysis in control (vector only transfected HEK293T lysate) and KIAA0020 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGAIILSSLLQSCDLEVANKVKAALKSLIPTLEKTKSTSKGI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KIAA0020 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KIAA0020 |
![Immunocytochemistry/Immunofluorescence: KIAA0020 Antibody [NBP1-87296] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/KIAA0020-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87296-img0008.jpg "Immunocytochemistry/Immunofluorescence: KIAA0020 Antibody [NBP1-87296] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human colon shows weak to moderate positivity in nucleoli in glandular cells.](http://images.novusbio.com/fullsize/KIAA0020-Antibody-Immunohistochemistry-Paraffin-NBP1-87296-img0012.jpg "Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human colon shows weak to moderate positivity in nucleoli in glandular cells.")
![Western Blot: KIAA0020 Antibody [NBP1-87296] - Analysis in human cell line HDLM-2.](http://images.novusbio.com/fullsize/KIAA0020-Antibody-Western-Blot-NBP1-87296-img0007.jpg "Western Blot: KIAA0020 Antibody [NBP1-87296] - Analysis in human cell line HDLM-2.")
![Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human breast shows nuclear membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/KIAA0020-Antibody-Immunohistochemistry-Paraffin-NBP1-87296-img0002.jpg "Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human breast shows nuclear membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human kidney shows weak to moderate positivity in nucleoli in cells in tubules.](http://images.novusbio.com/fullsize/KIAA0020-Antibody-Immunohistochemistry-Paraffin-NBP1-87296-img0010.jpg "Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human kidney shows weak to moderate positivity in nucleoli in cells in tubules.")
![Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human testis shows weak to moderate positivity in nucleoli in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/KIAA0020-Antibody-Immunohistochemistry-Paraffin-NBP1-87296-img0011.jpg "Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human testis shows weak to moderate positivity in nucleoli in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human fallopian tube shows weak to moderate positivity in nucleoli in glandular cells.](http://images.novusbio.com/fullsize/KIAA0020-Antibody-Immunohistochemistry-Paraffin-NBP1-87296-img0013.jpg "Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human fallopian tube shows weak to moderate positivity in nucleoli in glandular cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/Haptoglobin_DHAPG0_ELISA_461.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/DATA_Haptoglobin_DHAPG0_ELISA_709.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")