PTH1R/PTHR1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PTH1R |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Theoretical MW |
66 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PTH1R/PTHR1 Antibody
Background
PTHR1, a Parathyroid Hormone Receptor, mediates PTH-dependent regulation of mineral-ion homeostasis. It also mediates the paracrine action of PTHRP in endochondral bone formation. Mutations in this receptor are responsible for disorders of calcium and bone metabolism such as chondrodysplasia, hypercalcemia, and chronic renal failure. Three promoters, P1, P2, and P3, regulate the expression of PTHR. PTHR1 has been reported to be expressed in bone, breast, brain, colon, GI, kidney, liver, placenta, skin, umbilical cord, and uterus. ESTs have been isolated from B-cell/lung/testis, brain, breast, fetus, heart, heart/melanocyte/uterus, kidney, liver/spleen, lung, placenta, and testis libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: BA
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: IHC
Publications for PTH1R/PTHR1 Antibody (NBP1-87192) (0)
There are no publications for PTH1R/PTHR1 Antibody (NBP1-87192).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTH1R/PTHR1 Antibody (NBP1-87192) (0)
There are no reviews for PTH1R/PTHR1 Antibody (NBP1-87192).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PTH1R/PTHR1 Antibody (NBP1-87192) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTH1R/PTHR1 Products
Research Areas for PTH1R/PTHR1 Antibody (NBP1-87192)
Find related products by research area.
|
Blogs on PTH1R/PTHR1