![Western Blot: PSMC1 Antibody [NBP1-80959] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Western-Blot-NBP1-80959-img0010.jpg "Western Blot: PSMC1 Antibody [NBP1-80959] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSMC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-80959 | Applications | Species |
|---|---|---|
| Thinon E, Serwa RA, Broncel M et al. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nat Commun 2014-09-26 [PMID: 25255805] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PSMC1 Antibody [NBP1-80959] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80959-img0008.jpg "Immunocytochemistry/Immunofluorescence: PSMC1 Antibody [NBP1-80959] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-80959-img0015.jpg "Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: PSMC1 Antibody [NBP1-80959] - Analysis in human cell line EFO-21.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Western-Blot-NBP1-80959-img0006.jpg "Western Blot: PSMC1 Antibody [NBP1-80959] - Analysis in human cell line EFO-21.")
![Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-80959-img0012.jpg "Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human prostate shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human skeletal muscle shows moderate nuclear postivity in myocytes.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-80959-img0013.jpg "Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human skeletal muscle shows moderate nuclear postivity in myocytes.")
![Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human pancreas shows moderate nuclear postivity in islets of Langerhans.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-80959-img0014.jpg "Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human pancreas shows moderate nuclear postivity in islets of Langerhans.")
![Western Blot: PSMC1 Antibody [NBP1-80959] - Characterization of potent & selective NMT inhibitors.(a) Structure & dual NMT1/NMT2 inhibitory potency of compound 1. (b) Crystal structure of 1 (grey) bound to NMT1 in the presence of Myr-CoA showing key water molecules (red spheres) & polar interactions (dashed lines). Key residues (NMT1 numbering) are shown for NMT1 (blue, PDB 4C2Y) & NMT2 (pink, PDB 4C2X), & for NMT1 with 1 bound (green, PDB 4C2Z). Myr-CoA or the Myr-CoA analogue (NHM) is shown in black/grey. Image generated in PyMOL (0.99rc6, DeLano Scientific LLC, //pymol.sourceforge.net/). (c) Viability (MTS assay) of HeLa cells exposed to compound 1 at concentrations & time points indicated; error bars, s.d. (n=6). (d) Compound 1 inhibits NMT activity dose-dependently in HeLa cells (BPD=before pull-down; PD=after pull-down on streptavidin-coated beads). In-gel fluorescence after YnMyr tagging was quantified (ImageJ) & the response (% relative intensity; error bars, s.d. (n=2)) plotted using GraFit 7.0 to determine TC50 (see Fig. 2a for TC50 determined for compound 1). Western blots against protein substrates of NMT show dose-dependent reduction in enrichment following inhibition (tubulin: non-substrate loading control). (e) Cells treated with azidohomoalanine (AHA), cycloheximide (CHX) or inhibitor 1 (or DMSO vehicle), were lysed & ligated (CuAAC) to an alkyne-TAMRA reagent67. In-gel fluorescence demonstrates inhibition of protein synthesis by CHX, but not by 1. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25255805), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-80959_rabbit-polyclonal-psmc1-antibody-3102024161608.jpg "Western Blot: PSMC1 Antibody [NBP1-80959] - Characterization of potent & selective NMT inhibitors.(a) Structure & dual NMT1/NMT2 inhibitory potency of compound 1. (b) Crystal structure of 1 (grey) bound to NMT1 in the presence of Myr-CoA showing key water molecules (red spheres) & polar interactions (dashed lines). Key residues (NMT1 numbering) are shown for NMT1 (blue, PDB 4C2Y) & NMT2 (pink, PDB 4C2X), & for NMT1 with 1 bound (green, PDB 4C2Z). Myr-CoA or the Myr-CoA analogue (NHM) is shown in black/grey. Image generated in PyMOL (0.99rc6, DeLano Scientific LLC, //pymol.sourceforge.net/). (c) Viability (MTS assay) of HeLa cells exposed to compound 1 at concentrations & time points indicated; error bars, s.d. (n=6). (d) Compound 1 inhibits NMT activity dose-dependently in HeLa cells (BPD=before pull-down; PD=after pull-down on streptavidin-coated beads). In-gel fluorescence after YnMyr tagging was quantified (ImageJ) & the response (% relative intensity; error bars, s.d. (n=2)) plotted using GraFit 7.0 to determine TC50 (see Fig. 2a for TC50 determined for compound 1). Western blots against protein substrates of NMT show dose-dependent reduction in enrichment following inhibition (tubulin: non-substrate loading control). (e) Cells treated with azidohomoalanine (AHA), cycloheximide (CHX) or inhibitor 1 (or DMSO vehicle), were lysed & ligated (CuAAC) to an alkyne-TAMRA reagent67. In-gel fluorescence demonstrates inhibition of protein synthesis by CHX, but not by 1. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25255805), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Lck [p Tyr394] Antibody (755103)](https://images.novusbio.com/images2/Lck_MAB7500_Immunocytochemistry_12319.jpg)
![Western Blot Lck [p Tyr394] Antibody (755103)](https://images.novusbio.com/images2/Lck_MAB7500_Western_Blot_12455.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")