PSGL-1/CD162 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SELPLG |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for PSGL-1/CD162 Antibody
Background
CD162, also known as p-selectin glycoprotein ligand-1 (PSGL-1), is a 120 - 220 kDa, mucin-like type I transmembrane glycoprotein. CD162 binds to CD62P (P-Selectin), CD62E (E-Selectin) and CD62L (L-Selectin). The interactions between P-selectin and P-selectin glycoprotein ligand-1 (PSGL-1) mediate the earliest "rolling" of leukocytes on the lumenal surface of activated endothelium, and the interaction between leukocytes and activated platelets or other leukocytes found at sites of inflammation. CD162 is expressed on neutrophils, monocytes, and most lymphocytes including NK and T cells but PSGL-1 stains B cells at significantly lower levels than other cell types.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: ELISA
Publications for PSGL-1/CD162 Antibody (NBP3-16974) (0)
There are no publications for PSGL-1/CD162 Antibody (NBP3-16974).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PSGL-1/CD162 Antibody (NBP3-16974) (0)
There are no reviews for PSGL-1/CD162 Antibody (NBP3-16974).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PSGL-1/CD162 Antibody (NBP3-16974) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PSGL-1/CD162 Products
Research Areas for PSGL-1/CD162 Antibody (NBP3-16974)
Find related products by research area.
|
Blogs on PSGL-1/CD162