Home » Protein phosphatase 1F » Protein phosphatase 1F Proteins » Protein phosphatase 1F Recombinant Protein Antigen

Protein phosphatase 1F Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Protein phosphatase 1F Protein (NBP1-88206PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Protein phosphatase 1F Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPM1F.

Source: E. coli

Amino Acid Sequence: VVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPM1F
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88206.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Protein phosphatase 1F Recombinant Protein Antigen

  • Ca(2+)/calmodulin-dependent protein kinase phosphatase
  • CaMKPaseCaM-kinase phosphatase
  • EC 3.1.3.16
  • FEM-2
  • hFEM-2
  • KIAA0015POPX2CAMKP
  • Partner of PIX 2
  • PP2C phosphatase
  • Protein fem-2 homolog
  • protein phosphatase 1F (PP2C domain containing)
  • protein phosphatase 1F
  • protein phosphatase, Mg2+/Mn2+ dependent, 1F

Background

Protein phosphatase 1F is encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPM1E Antibody
NBP1-86649
Immunocytochemistry/ Immunofluorescence PPM1E Antibody
Immunohistochemistry-Paraffin PPM1E Antibody
Immunohistochemistry-Paraffin PPM1E Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CaMKIV Antibody
(1G4P4)
NBP3-16802
Immunocytochemistry/ Immunofluorescence CaMKIV Antibody (1G4P4)
Western Blot CaMKIV Antibody (1G4P4)
Immunocytochemistry/ Immunofluorescence CaMKIV Antibody (1G4P4)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CaM Kinase I
Antibody
AF7899
Immunohistochemistry CaM Kinase I Antibody
Western Blot CaM Kinase I Antibody
Species: Hu
Applications: IHC, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
PP2C alpha/PPM1A
Antibody
NBP1-32751
Western Blot PP2C alpha/PPM1A Antibody
Immunocytochemistry/ Immunofluorescence PP2C alpha/PPM1A Antibody
Immunohistochemistry-Paraffin PP2C alpha/PPM1A Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
RhoD Antibody -
Azide and BSA Free
NBP3-04527
Immunocytochemistry/ Immunofluorescence RhoD Antibody - Azide and BSA Free
Western Blot RhoD Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence RhoD Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Patched 1/PTCH
Antibody (413220) [Un ...
MAB41051
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
(10 Publications)
Species: Hu, Mu
Applications: IHC, WB
PPM1D Antibody
NBP1-87249
Immunocytochemistry/ Immunofluorescence PPM1D Antibody
Immunohistochemistry-Paraffin PPM1D Antibody
Immunohistochemistry-Paraffin PPM1D Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PP2A alpha [p
Tyr307] Antibody [Unc ...
AF3989
Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu, Rt
Applications: WB
Serum Response
Factor SRF Antibody ( ...
NBP3-13785
Flow Cytometry Serum Response Factor SRF Antibody (PCRP-SRF-1F7)
Immunocytochemistry/ Immunofluorescence Serum Response Factor SRF Antibody (PCRP-SRF-1F7)
Immunohistochemistry-Paraffin Serum Response Factor SRF Antibody (PCRP-SRF-1F7)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Protein
phosphatase 1F Recomb ...
NBP1-88206PEP
Protein phosphatase 1F Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Protein phosphatase 1F Protein (NBP1-88206PEP) (0)

There are no publications for Protein phosphatase 1F Protein (NBP1-88206PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein phosphatase 1F Protein (NBP1-88206PEP) (0)

There are no reviews for Protein phosphatase 1F Protein (NBP1-88206PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Protein phosphatase 1F Protein (NBP1-88206PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protein phosphatase 1F Products

Research Areas for Protein phosphatase 1F Protein (NBP1-88206PEP)

Find related products by research area.

Blogs on Protein phosphatase 1F

There are no specific blogs for Protein phosphatase 1F, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Frozen: Rhodopsin Antibody (4D2) [NBP2-59690] - Zebrafish retina (outer nuclear layer). PFA and methanol fixed 7 um sections. Rhodopsin antibody O/N incubation at 1:500. IHC-Fr image submitted by a verified customer review.
Rhodopsin Antibody (4D2)
NBP2-59690-100ug

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Protein phosphatase 1F Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PPM1F