Home » PRAS40 » PRAS40 Proteins » PRAS40 Recombinant Protein Antigen

PRAS40 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PRAS40 Recombinant Protein Antigen (NBP2-54956PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PRAS40 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKT1S1.

Source: E. coli

Amino Acid Sequence: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKT1S1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54956.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRAS40 Recombinant Protein Antigen

  • 40 kDa
  • AKT1 substrate 1 (proline-rich)
  • AKT1S1
  • Lobe
  • MGC2865
  • PRAS40
  • proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate

Background

Proline Rich Akt Substrate (PRAS40) is a 40 kDa substrate of Akt. Akt and PRAS40 can be found in the phosphoinositide 3 kinase (PI3K) pathway, which plays a role in glucose uptake, cell growth, and apoptosis inhibition. PRAS40 is a 14-3-3 binding protein that reacts with insulin, but whose precise function is not yet known. It may bind SH3 and WW domain containing proteins resulting in a change of function. Activated Akt phosphorylates PRAS40 on threonine 246. Mutation of PRAS40 threonine 246 has been shown to be apoptotic.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
RPTOR Antibody
NBP2-24837
Immunocytochemistry/ Immunofluorescence RPTOR Antibody
Immunohistochemistry-Paraffin RPTOR Antibody
Western Blot RPTOR Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
4EBP1 Antibody
NB200-157
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
14-3-3 Antibody
NBP2-27202
Simple Western 14-3-3 Antibody
Immunocytochemistry/ Immunofluorescence 14-3-3 Antibody
Western Blot 14-3-3 Antibody
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
TSC2 Antibody
(SC05-59)
NBP2-67552
Flow Cytometry TSC2 Antibody (SC05-59)
Immunohistochemistry-Paraffin TSC2 Antibody (SC05-59)
Western Blot TSC2 Antibody (SC05-59)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TORC1 Antibody
NBP1-89865
Immunohistochemistry-Paraffin TORC1 Antibody
Immunohistochemistry-Paraffin TORC1 Antibody
Immunohistochemistry-Paraffin TORC1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(16 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Rheb Antibody
(2C11)
H00006009-M01
Western Blot Rheb Antibody (2C11)
ELISA Rheb Antibody (2C11)
Western Blot Rheb Antibody (2C11)
(10 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
PRAS40 Recombinant
Protein Antigen
NBP2-54956PEP
PRAS40 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PRAS40 Recombinant Protein Antigen (NBP2-54956PEP) (0)

There are no publications for PRAS40 Recombinant Protein Antigen (NBP2-54956PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAS40 Recombinant Protein Antigen (NBP2-54956PEP) (0)

There are no reviews for PRAS40 Recombinant Protein Antigen (NBP2-54956PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRAS40 Recombinant Protein Antigen (NBP2-54956PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRAS40 Products

Research Areas for PRAS40 Recombinant Protein Antigen (NBP2-54956PEP)

Find related products by research area.

Blogs on PRAS40.

Check out the latest blog posts on PRAS40.
Mapping Signal Transduction with mTOR Antibodies
The protein encoded by mTOR (mammalian target of rapamycin), also known as dTOR in Drosophila, belongs to a family of phosphatidylinositol kinase-related kinases. These kinases regulate fundamental processes of cell growth, proliferation, metabolism...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRAS40 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AKT1S1