Home » PKR » PKR Proteins » PKR Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PKR Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PKR Protein (NBP1-84878PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PKR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF2AK2.

Source: E. coli

Amino Acid Sequence: EFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF2AK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84878.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKR Recombinant Protein Antigen

  • double stranded RNA activated protein kinase
  • EC 2.7.11.1
  • eIF-2A protein kinase 2
  • EIF2AK1
  • EIF2AK2
  • eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase
  • interferon-induced, double-stranded RNA-activated protein kinase
  • interferon-inducible double stranded RNA dependent
  • interferon-inducible elF2alpha kinase
  • Interferon-inducible RNA-dependent protein kinase
  • P68 Kinase
  • PKR
  • PKRp68 kinase
  • PPP1R83
  • PRKR
  • PRKRMGC126524
  • Protein Kinase R
  • Protein kinase RNA-activated

Background

Protein kinase R (PKR) is a serine/threonine kinase that is induced by interferon and activated by double-stranded RNA. Upon activation, PKR is autophosphorylated at multiple sites and phosphorylates the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
RNase L Antibody
(2E9) - BSA Free
NB100-351
Immunohistochemistry RNase L Antibody (2E9) - BSA Free
Knockout Validated RNase L Antibody (2E9) - BSA Free
Western Blot RNase L Antibody (2E9) - BSA Free
(14 Publications)
Species: Ha, Hu, Mu(-), Pm, Rt(-)
Applications: ELISA, IHC, IHC-P, KO, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
eIF2 alpha/EIF2S1
Antibody (OTI3H4)
NBP2-02669
Flow Cytometry eIF2 alpha/EIF2S1 Antibody (OTI3H4)
Western Blot eIF2 alpha/EIF2S1 Antibody (OTI3H4)
Immunohistochemistry-Paraffin eIF2 alpha/EIF2S1 Antibody (OTI3H4)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PERK Antibody
[Unconjugated]
AF3999
Western Blot PERK Antibody [Unconjugated]
Knockout Validated PERK Antibody [Unconjugated]
Western Blot PERK Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: KO, WB
MxA/Mx1 Antibody
NBP1-32905
Immunohistochemistry-Paraffin MxA/Mx1 Antibody
Western Blot MxA/Mx1 Antibody
Western Blot MxA/Mx1 Antibody
(1 Review)
(1 Publication)
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
TLR3 Antibody
(40C1285.6) - BSA Fre
NBP2-24875
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
Western Blot TLR3 Antibody (40C1285.6) - BSA Free
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
(87 Publications)
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western PKR Antibody (HL71/10) [Unconjugated]
Immunocytochemistry PKR Antibody (HL71/10) [Unconjugated]
Western Blot PKR Antibody (HL71/10) [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB
STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
IFN-beta
[Unconjugated]
8499-IF
Binding Activity IFN-beta [Unconjugated]
(50 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(447 Publications)
Species: Hu
Applications: BA
DNAJC3 Antibody
NBP2-48704
Western Blot DNAJC3 Antibody
Immunohistochemistry-Paraffin DNAJC3 Antibody
Immunocytochemistry/ Immunofluorescence DNAJC3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RIG-I Antibody
AF4859
Western Blot RIG-I Antibody
(2 Publications)
Species: Hu
Applications: WB
IRF1 Antibody
AF4715
Western Blot IRF1 Antibody
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(638 Publications)
Species: Mu
Applications: ELISA
GCN2 [p Thr899]
Antibody
AF7605
Western Blot GCN2 [p Thr899] Antibody
(2 Publications)
Species: Hu
Applications: WB
ADAR Antibody
(CL0176)
NBP3-05500
Immunocytochemistry/ Immunofluorescence ADAR Antibody (CL0176)
Immunohistochemistry-Paraffin ADAR Antibody (CL0176)
Immunohistochemistry-Paraffin ADAR Antibody (CL0176)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
PKR Recombinant
Protein Antigen
NBP1-84878PEP
PKR Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PKR Protein (NBP1-84878PEP) (0)

There are no publications for PKR Protein (NBP1-84878PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKR Protein (NBP1-84878PEP) (0)

There are no reviews for PKR Protein (NBP1-84878PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKR Protein (NBP1-84878PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKR Products

Research Areas for PKR Protein (NBP1-84878PEP)

Find related products by research area.

Blogs on PKR.

Check out the latest blog posts on PKR.
eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni...  Read full blog post.
PKR - Mediating cellular stress responses through multiple signaling pathways
Protein kinase R (PKR) is an intracellular stress-sensing protein that is able to detect and respond to viral infections. While PKR is able to sense and respond to a variety of signals, dsRNA is a well-characterized ligand. dsRNA produced during v...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKR Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EIF2AK2