![Western Blot: PIG3 Antibody [NBP1-87274] - Analysis using Anti-TP53I3 antibody NBP1-87274 (A) shows similar pattern to independent antibody NBP1-87275 (B).](http://images.novusbio.com/fullsize/PIG3-Antibody-Western-Blot-NBP1-87274-img0008.jpg "Western Blot: PIG3 Antibody [NBP1-87274] - Analysis using Anti-TP53I3 antibody NBP1-87274 (A) shows similar pattern to independent antibody NBP1-87275 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TP53I3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PIG3 Antibody (NBP1-87274)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TP53I3 |
![Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87274] - Staining in human esophagus and skin tissues using anti-TP53I3 antibody. Corresponding TP53I3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PIG3-Antibody-Immunohistochemistry-Paraffin-NBP1-87274-img0007.jpg "Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87274] - Staining in human esophagus and skin tissues using anti-TP53I3 antibody. Corresponding TP53I3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87274] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells of tubules.](http://images.novusbio.com/fullsize/PIG3-Antibody-Immunohistochemistry-Paraffin-NBP1-87274-img0002.jpg "Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87274] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells of tubules.")
![Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87274] - Staining of human esophagus shows high expression.](http://images.novusbio.com/fullsize/PIG3-Antibody-Immunohistochemistry-Paraffin-NBP1-87274-img0005.jpg "Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87274] - Staining of human esophagus shows high expression.")
![Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87274] - Staining of human skin shows low expression as expected.](http://images.novusbio.com/fullsize/PIG3-Antibody-Immunohistochemistry-Paraffin-NBP1-87274-img0006.jpg "Immunohistochemistry-Paraffin: PIG3 Antibody [NBP1-87274] - Staining of human skin shows low expression as expected.")
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_108.jpg)
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_698.jpg)
![N/A GDF-15 [HRP]](https://images.novusbio.com/images2/GDF15_DGD150_ELISA_2661.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")