Home » PICK1 » PICK1 Proteins » PICK1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PICK1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PICK1 Recombinant Protein Antigen (NBP2-57239PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PICK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PICK1.

Source: E. coli

Amino Acid Sequence: LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PICK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57239.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PICK1 Recombinant Protein Antigen

  • alpha binding protein
  • dJ1039K5
  • MGC15204
  • PICK
  • PRKCA-binding protein
  • PRKCABPprotein interacting with PRKCA
  • Protein interacting with C kinase 1
  • protein interacting with PRKCA 1
  • Protein kinase C-alpha-binding protein

Background

PSD-95/DLG/ZO-1 (PDZ) domain-containing proteins play a central role in synaptic membrane protein localization. The protein interacting with protein kinase C (PICK 1) is a synaptic PDZ domain protein that also contains a coiled-coil and acidic domain. Studies indicate that PICK 1 functions as a targeting and transport protein and has been shown to interact with protein kinase C alpha (PKC alpha), AMPA-type glutamate receptors, and several other membrane receptors via its PDZ domain. The interaction of PICK 1 with PKC alpha is highly dependent on the activation of the kinase. It appears that PICK 1 directs the activated form of PKC alpha to membrane anchored GluR2. Once phosphorylated by PKC alpha, GluR2 is released from the synaptic anchor proteins. Once released, GluR2 is transported from the synaptic membrane in a PICK 1-dependent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GluR2 Antibody
(JU20-43)
NBP2-75510
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunohistochemistry-Paraffin GluR2 Antibody (JU20-43)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
mGluR2 Antibody -
BSA Free
NLS892
Immunohistochemistry-Paraffin mGluR2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence mGluR2 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR2 Antibody - BSA Free
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
GRIP1 Antibody -
BSA Free
NBP2-41211
Western Blot GRIP1 Antibody - BSA Free
Immunohistochemistry GRIP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRIP1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NCOA2 Antibody
NB100-1756
Immunohistochemistry NCOA2 Antibody
Immunocytochemistry/ Immunofluorescence NCOA2 Antibody
Immunocytochemistry/ Immunofluorescence NCOA2 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NSF Antibody
NBP1-87035
Immunocytochemistry/ Immunofluorescence NSF Antibody
Immunohistochemistry-Paraffin NSF Antibody
Western Blot NSF Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
(1 Review)
(31 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Human Galectin-12
ELISA Kit (Colorimetr ...
NBP2-76718
ELISA Human Galectin-12 ELISA Kit (Colorimetric)
ELISA Human Galectin-12 ELISA Kit (Colorimetric)
(1 Publication)
Species: Hu
Applications: ELISA
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody
(5 Reviews)
(20 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
ACCN2 Antibody
(S271-44)
NBP2-22409
Western Blot ACCN2 Antibody (S271-44)
Immunocytochemistry/ Immunofluorescence ACCN2 Antibody (S271-44)
Immunocytochemistry/ Immunofluorescence ACCN2 Antibody (S271-44)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
ACCN1 Antibody
NBP2-14321
Immunohistochemistry-Paraffin ACCN1 Antibody
Western Blot ACCN1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
SHBG [HRP]
DSHBG0B
N/A SHBG [HRP]
N/A SHBG [HRP]
N/A SHBG [HRP]
(9 Publications)
Species: Hu
Applications: ELISA
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
mGluR7 Antibody -
BSA Free
NLS921
Immunohistochemistry-Paraffin mGluR7 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR7 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR7 Antibody - BSA Free
Species: Bv, Hu
Applications: ICC, IHC, IHC-P, WB
GluR1 Antibody
(S355-1)
NBP2-22399
Western Blot GluR1 Antibody (S355-1)
Immunocytochemistry/ Immunofluorescence GluR1 Antibody (S355-1)
Immunocytochemistry/ Immunofluorescence GluR1 Antibody (S355-1)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
(1 Review)
(31 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for PICK1 Recombinant Protein Antigen (NBP2-57239PEP) (0)

There are no publications for PICK1 Recombinant Protein Antigen (NBP2-57239PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PICK1 Recombinant Protein Antigen (NBP2-57239PEP) (0)

There are no reviews for PICK1 Recombinant Protein Antigen (NBP2-57239PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PICK1 Recombinant Protein Antigen (NBP2-57239PEP). (Showing 1 - 1 of 1 FAQ).

  1. Here is a difficult request. We are looking for an antibody with the following specifications: Anti-PICK1 Reactive in mouse without sodium azide, so it can be injected into the mouse without compromising its life With PBS (for example) It does not necessarily have to be guaranteed. Have you got anything like it?
    • Unfortunately all of our anti-PICK1 mouse-reactive antibodies are supplied in sodium azide. We do have anti human PICK1 without preservatives, but that would not be suitable if you are working with mouse samples. NB100-41403 contains only 0.02% sodium azide which is the lowest percentage. We also offer an Antibody Concentration and Clean Up Antibody Purification Kit which can be used to reduce the concentration of unwanted additives often found in antibody formulations, such as sodium azide, glycine or tris. This kit is offered in two sizes: cat# 861-0005 includes 1 column and cat# 861-0010 includes 3 columns.

Additional PICK1 Products

Research Areas for PICK1 Recombinant Protein Antigen (NBP2-57239PEP)

Find related products by research area.

Blogs on PICK1

There are no specific blogs for PICK1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
PSD-95 Antibody (6G6-1C9) - BSA Free
NB300-556
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.
Tight Junction Protein 1 Antibody
NBP1-85047

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PICK1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PICK1