Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC |
Clone | 3J0F6 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PI 3-Kinase p110 delta (O00329). EESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | PIK3CD |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PI 3-Kinase p110 delta Antibody (NBP3-15889)Find related products by research area.
|
PI3 Kinase p110 delta - A cell-type specific lipid kinase with essential roles in leukocyte biology Phosphatidylinositol 3-kinases (PI3Ks) are a group of lipid kinases with important roles in signal transduction. PI3Ks are involved in signal propagation for diverse receptors including tyrosine kinase receptors and G-protein coupled receptors. Cla... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PIK3CD |