Home » Phospholipase D2 » Phospholipase D2 Proteins » Phospholipase D2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Phospholipase D2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Phospholipase D2 Recombinant Protein Antigen (NBP1-87576PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Phospholipase D2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLD2.

Source: E. coli

Amino Acid Sequence: CFGVILGANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87576.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Phospholipase D2 Recombinant Protein Antigen

  • Choline phosphatase 2
  • EC 3.1.4.4
  • hPLD2
  • Phosphatidylcholine-hydrolyzing phospholipase D2
  • phospholipase D2
  • PLD 2
  • PLD1C

Background

Phosphatidylcholine (PC)-specific phospholipases D (PLDs; EC 3.1.4.4) catalyze the hydrolysis of PC to produce phosphatidic acid and choline. Activation of PC-specific PLDs occurs as a consequence of agonist stimulation of both tyrosine kinase and G protein-coupled receptors. PC-specific PLDs have been proposed to function in regulated secretion, cytoskeletal reorganization, transcriptional regulation, and cell cycle control.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLD1 Antibody
NBP2-34078
Immunocytochemistry/ Immunofluorescence PLD1 Antibody
Immunohistochemistry-Paraffin PLD1 Antibody
Immunohistochemistry-Paraffin PLD1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PRKCSH Antibody
NBP1-32006
Immunocytochemistry/ Immunofluorescence PRKCSH Antibody
Western Blot PRKCSH Antibody
Immunocytochemistry/ Immunofluorescence PRKCSH Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot Pallidin Antibody (OTI1H9)
Flow Cytometry Pallidin Antibody (OTI1H9)
Immunohistochemistry-Paraffin Pallidin Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Recombinant Human
PRH1 His Protein
NBP2-23368
SDS-PAGE Recombinant Human PRH1 His Protein
Species: Hu
Applications: PAGE
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot EPB42 Antibody (2G12)
ELISA EPB42 Antibody (2G12)
Immunocytochemistry/ Immunofluorescence EPB42 Antibody (2G12)
Species: Hu
Applications: ELISA, ICC/IF, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(834 Publications)
Species: Hu
Applications: BA
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
ARF1 Antibody
NBP2-29906
Immunocytochemistry/ Immunofluorescence ARF1 Antibody
Immunohistochemistry-Paraffin ARF1 Antibody
Immunohistochemistry-Paraffin ARF1 Antibody
(2 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
ARF6 Antibody -
BSA Free
NBP2-41263
Immunohistochemistry ARF6 Antibody - BSA Free
Western Blot ARF6 Antibody - BSA Free
Immunohistochemistry ARF6 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Phospholipase D2
Recombinant Protein A ...
NBP1-87576PEP
Phospholipase D2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Phospholipase D2 Recombinant Protein Antigen (NBP1-87576PEP) (0)

There are no publications for Phospholipase D2 Recombinant Protein Antigen (NBP1-87576PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase D2 Recombinant Protein Antigen (NBP1-87576PEP) (0)

There are no reviews for Phospholipase D2 Recombinant Protein Antigen (NBP1-87576PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Phospholipase D2 Recombinant Protein Antigen (NBP1-87576PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Phospholipase D2 Products

Research Areas for Phospholipase D2 Recombinant Protein Antigen (NBP1-87576PEP)

Find related products by research area.

Blogs on Phospholipase D2

There are no specific blogs for Phospholipase D2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Phospholipase D2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PLD2