![Western Blot: PHGDH Antibody (CL0555) [NBP2-52939] - Lane 1: Marker [kDa], Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/PHGDH-Antibody-CL0555-Western-Blot-NBP2-52939-img0008.jpg "Western Blot: PHGDH Antibody (CL0555) [NBP2-52939] - Lane 1: Marker [kDa], Lane 2: Human cell line RT-4")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL0555 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PHGDH |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PHGDH Antibody (NBP2-52939)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PHGDH |
![Immunocytochemistry/Immunofluorescence: PHGDH Antibody (CL0555) [NBP2-52939] - Staining of MCF7 cells using the Anti-PHGDH monoclonal antibody, showing specific staining in the cytosol and the plasma membrane in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/PHGDH-Antibody-CL0555-Immunocytochemistry-Immunofluorescence-NBP2-52939-img0009.jpg "Immunocytochemistry/Immunofluorescence: PHGDH Antibody (CL0555) [NBP2-52939] - Staining of MCF7 cells using the Anti-PHGDH monoclonal antibody, showing specific staining in the cytosol and the plasma membrane in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Western Blot: PHGDH Antibody (CL0555) [NBP2-52939] - Lane 1: Marker [kDa], Lane 2: Human cell line HeLa cytoplasmic fraction , Lane 3: Human cell line HeLa membrane fraction , Lane 4: Human cell line HeLa nuclear fraction , Lane 5: Human cell line HeLa chromatin fraction , Lane 6: Human cell line HeLa cytos](http://images.novusbio.com/fullsize/PHGDH-Antibody-CL0555-Western-Blot-NBP2-52939-img0007.jpg "Western Blot: PHGDH Antibody (CL0555) [NBP2-52939] - Lane 1: Marker [kDa], Lane 2: Human cell line HeLa cytoplasmic fraction , Lane 3: Human cell line HeLa membrane fraction , Lane 4: Human cell line HeLa nuclear fraction , Lane 5: Human cell line HeLa chromatin fraction , Lane 6: Human cell line HeLa cytos")
![Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Analysis in human pancreas and skeletal muscle tissues using NBP2-52939 antibody. Corresponding PHGDH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/antibody/nbp2-52939_mouse-monoclonal-phgdh-antibody-cl0555-immunohistochemistry-paraffin-188202393027.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Analysis in human pancreas and skeletal muscle tissues using NBP2-52939 antibody. Corresponding PHGDH RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-52939_mouse-monoclonal-phgdh-antibody-cl0555-immunohistochemistry-paraffin-188202393135..jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/antibody/nbp2-52939_mouse-monoclonal-phgdh-antibody-cl0555-immunohistochemistry-paraffin-188202393244..jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/antibody/nbp2-52939_mouse-monoclonal-phgdh-antibody-cl0555-immunohistochemistry-paraffin-188202393356..jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-52939_mouse-monoclonal-phgdh-antibody-cl0555-immunohistochemistry-paraffin-18820239356..jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (CL0555) [NBP2-52939] -Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (735301) [Unconjugated]](https://images.novusbio.com/images2/HPGDS_MAB6487_Western_Blot_11636.jpg)
![Immunocytochemistry Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (735301) [Unconjugated]](https://images.novusbio.com/images2/HPGDS_MAB6487_Immunocytochemistry__Immunofluorescence_19604.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")