![Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6. Analysis of PHGDH expression in human liver.](http://images.novusbio.com/fullsize/PHGDH-Antibody-4A3-1D6-Western-Blot-H00026227-M01-img0018.jpg "Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6. Analysis of PHGDH expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, IP |
| Clone | 4A3-1D6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF |
| Specificity | PHGDH - phosphoglycerate dehydrogenase |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PHGDH |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against recominant protein, tissue lysate and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publications using H00026227-M01 | Applications | Species |
|---|---|---|
| Pollari S, Kakonen SM, Edgren H et al. Enhanced serine production by bone metastatic breast cancer cells stimulates osteoclastogenesis. Breast Cancer Res Treat. 2010-03-30 [PMID: 20352489] | ||
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
Secondary Antibodies |
Isotype Controls |
Research Areas for PHGDH Antibody (H00026227-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on HeLa cell. Antibody concentration 1 ~ 10 ug/ml.](http://images.novusbio.com/fullsize/PHGDH-Antibody-4A3-1D6-Immunocytochemistry-Immunofluorescence-H00026227-M01-img0010.jpg "Immunocytochemistry/Immunofluorescence: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on HeLa cell. Antibody concentration 1 ~ 10 ug/ml.")
![Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/PHGDH-Antibody-4A3-1D6-Immunohistochemistry-Paraffin-H00026227-M01-img0014.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.")
![Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6. Analysis of PHGDH expression in A-431.](http://images.novusbio.com/fullsize/PHGDH-Antibody-4A3-1D6-Western-Blot-H00026227-M01-img0016.jpg "Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6. Analysis of PHGDH expression in A-431.")
![Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6 Analysis of PHGDH expression in Jurkat.](http://images.novusbio.com/fullsize/PHGDH-Antibody-4A3-1D6-Western-Blot-H00026227-M01-img0017.jpg "Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - PHGDH monoclonal antibody (M01), clone 4A3-1D6 Analysis of PHGDH expression in Jurkat.")
![Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody (M01), clone 4A3-1D6.Lane 1: PHGDH transfected lysate(56.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PHGDH-Antibody-4A3-1D6-Western-Blot-H00026227-M01-img0019.jpg "Western Blot: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody (M01), clone 4A3-1D6.Lane 1: PHGDH transfected lysate(56.7 KDa).Lane 2: Non-transfected lysate.")
![Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 1 ~ 10 ug/ml.](http://images.novusbio.com/fullsize/PHGDH-Antibody-4A3-1D6-Immunohistochemistry-Paraffin-H00026227-M01-img0012.jpg "Immunohistochemistry-Paraffin: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 1 ~ 10 ug/ml.")
![Immunoprecipitation: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of PHGDH transfected lysate using anti-PHGDH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHGDH MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/PHGDH-Antibody-4A3-1D6-Immunoprecipitation-H00026227-M01-img0015.jpg "Immunoprecipitation: PHGDH Antibody (4A3-1D6) [H00026227-M01] - Analysis of PHGDH transfected lysate using anti-PHGDH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHGDH MaxPab rabbit polyclonal antibody.")
![Western Blot Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (735301) [Unconjugated]](https://images.novusbio.com/images2/HPGDS_MAB6487_Western_Blot_11636.jpg)
![Immunocytochemistry Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (735301) [Unconjugated]](https://images.novusbio.com/images2/HPGDS_MAB6487_Immunocytochemistry__Immunofluorescence_19604.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")