Home » PHF19 » PHF19 Proteins » Recombinant Human PHF19 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human PHF19 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human PHF19 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-207 of Human PHF19

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PHF19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
48.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHF19 GST (N-Term) Protein

  • DKFZP727G051
  • hPCL3
  • MGC131698
  • MGC149712
  • MGC23929
  • MTF2L1
  • PCL3MGC149713
  • PHD finger protein 19
  • polycomb like 3
  • polycomb-like 3
  • Polycomb-like protein 3

Background

PHF19 acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

EZH2/KMT6 Antibody
[Unconjugated]
AF4767
Western Blot EZH2/KMT6 Antibody [Unconjugated]
Western Blot EZH2/KMT6 Antibody [Unconjugated]
Western Blot EZH2/KMT6 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: ICC, WB
MTF2 Antibody
AF6846
Immunohistochemistry MTF2 Antibody
Species: Hu
Applications: IHC
SUZ12 Antibody
(448909) [Unconjugate
MAB4184
Immunoprecipitation SUZ12 Antibody (448909) [Unconjugated]
Western Blot SUZ12 Antibody (448909) [Unconjugated]
Immunocytochemistry SUZ12 Antibody (448909) [Unconjugated]
(1 Publication)
Species: Hu, Mu
Applications: ICC, IP, WB
HIC1 Antibody
(4E11)
H00003090-M01
Western Blot HIC1 Antibody (4E11)
Immunocytochemistry/ Immunofluorescence HIC1 Antibody (4E11)
Sandwich ELISA HIC1 Antibody (4E11)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
TRAF-1 Antibody
NB100-56170
Immunohistochemistry-Paraffin TRAF-1 Antibody
Immunohistochemistry-Paraffin TRAF-1 Antibody
Western Blot TRAF-1 Antibody
(1 Publication)
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, IP, WB
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
EGLN2/PHD1 Antibody
AF6394
Western Blot EGLN2/PHD1 Antibody
Immunohistochemistry EGLN2/PHD1 Antibody
Immunohistochemistry EGLN2/PHD1 Antibody
(7 Publications)
Species: Hu
Applications: IP, WB
VEGFR3/Flt-4
Antibody [Unconjugate
AF743
Flow Cytometry VEGFR3/Flt-4 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]
(3 Reviews)
(140 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, WB
PRC1 Antibody -
BSA Free
NBP2-81882
Western Blot PRC1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRC1 Antibody - BSA Free
Immunohistochemistry PRC1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PKD2L1 Antibody
(4F9)
H00009033-M01
Western Blot PKD2L1 Antibody (4F9)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
EGLN1/PHD2 Antibody
NB100-137
Flow Cytometry EGLN1/PHD2 Antibody
Western Blot EGLN1/PHD2 Antibody
Immunohistochemistry EGLN1/PHD2 Antibody
(12 Reviews)
(92 Publications)
Species: Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KD, KO, Simple Western, WB
PHF1 Antibody
NBP1-82613
Immunohistochemistry PHF1 Antibody
Western Blot PHF1 Antibody
Immunohistochemistry-Paraffin PHF1 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CtBP1 Antibody
(2G7)
H00001487-M01
Western Blot CtBP1 Antibody (2G7)
Immunocytochemistry/ Immunofluorescence CtBP1 Antibody (2G7)
Immunohistochemistry-Paraffin CtBP1 Antibody (2G7)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
SS18L1 Antibody
NBP2-20486
Immunoprecipitation SS18L1 Antibody
Immunohistochemistry-Paraffin SS18L1 Antibody
Immunocytochemistry/ Immunofluorescence SS18L1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MATH1 Antibody
(1B12)
H00000474-M01
ELISA MATH1 Antibody (1B12)
Immunocytochemistry/ Immunofluorescence MATH1 Antibody (1B12)
Species: Hu
Applications: ELISA, ICC/IF, WB
Lysine
(K)-specific Demethyl ...
NBP1-06640
Western Blot Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - BSA Free
Western Blot Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - BSA Free
(4 Reviews)
(15 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, WB

Publications for PHF19 Recombinant Protein (H00026147-P01) (0)

There are no publications for PHF19 Recombinant Protein (H00026147-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF19 Recombinant Protein (H00026147-P01) (0)

There are no reviews for PHF19 Recombinant Protein (H00026147-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF19 Recombinant Protein (H00026147-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHF19 Products

Blogs on PHF19

There are no specific blogs for PHF19, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

bEnd.3 cells, a mouse endothelioma cell line, was stained with Goat Anti-Mouse VEGFR3/Flt‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF743, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by PE-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
VEGFR3/Flt-4 Antibody [Unconjugated]
AF743
Flow Cytometry: EGLN1/PHD2 Antibody [NB100-137] - An intracellular stain was performed on Jurkat cells with NB100-137AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
EGLN1/PHD2 Antibody
NB100-137

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHF19 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol PHF19