Home » PGAP3 » PGAP3 Proteins » PGAP3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PGAP3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PGAP3 Protein (NBP1-86692PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PGAP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PGAP3.

Source: E. coli

Amino Acid Sequence: SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PGAP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86692.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PGAP3 Recombinant Protein Antigen

  • AGLA546
  • CAB2COS16 homolog
  • Gene coamplified with ERBB2 protein
  • MGC9753hCOS16
  • PER1
  • per1-like domain containing 1
  • PERLD1PER1-like domain-containing protein 1
  • post-GPI attachment to proteins 3
  • post-GPI attachment to proteins factor 3
  • PP1498

Background

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels aids the function of the calcium channel by increasing the peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. CAB2 is a membrane protein that is expressed in all tissues. The unprocessed precursor is 660 amino acids in length and has a predicted molecular weight of 74.5KDa. It belongs to the calcium channel beta subunit family and contains one SH3 domain. CAB2 is involved in the MAPK signalling pathway and is also associated with Lambert-Eaton myasthenic syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PER2 Antibody -
BSA Free
NB100-125
Western Blot PER2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PER2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PER2 Antibody - BSA Free
(3 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CLOCK Antibody
NB100-126
Western Blot CLOCK Antibody
(4 Publications)
Species: Hu, Mu
Applications: ChIP, WB
CRY1 Antibody
[Unconjugated]
AF3764
Immunocytochemistry CRY1 Antibody [Unconjugated]
Immunohistochemistry CRY1 Antibody [Unconjugated]
Immunohistochemistry CRY1 Antibody [Unconjugated]
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
PER3 Antibody
NBP1-86436
Immunohistochemistry-Paraffin PER3 Antibody
Immunohistochemistry-Paraffin PER3 Antibody
Immunohistochemistry-Paraffin PER3 Antibody
Species: Hu
Applications: IHC, IHC-P
CRY2 Antibody
(OTI1H5)
NBP2-00749
Flow Cytometry CRY2 Antibody (OTI1H5)
Flow Cytometry CRY2 Antibody (OTI1H5)
Immunohistochemistry-Paraffin CRY2 Antibody (OTI1H5)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB
FoxC2 Antibody
AF6989
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
(27 Publications)
Species: Mu
Applications: IHC
D Box Binding
Protein Antibody
NBP2-83997
Immunohistochemistry D Box Binding Protein Antibody
Western Blot D Box Binding Protein Antibody
Western Blot D Box Binding Protein Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Vitamin D BP
Antibody
NBP1-88027
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
(2 Reviews)
(1 Publication)
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Immunofluorescence HSD17B4 Antibody (OTI4C4)
Immunofluorescence HSD17B4 Antibody (OTI4C4)
Immunohistochemistry HSD17B4 Antibody (OTI4C4)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
c-Fos Antibody
(2H2)
NBP2-50037
Western Blot c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
DEC1 Antibody -
BSA Free
NB100-1800
Western Blot DEC1 Antibody - BSA Free
Western Blot DEC1 Antibody - BSA Free
Immunoprecipitation DEC1 Antibody - BSA Free
(2 Reviews)
(43 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NPAS2 Antibody
NBP1-88612
Immunocytochemistry/ Immunofluorescence NPAS2 Antibody
Immunohistochemistry NPAS2 Antibody
Immunohistochemistry-Paraffin NPAS2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Neurophysin
II/Arg-vasopressin An ...
AF009
Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
PGAP3 Recombinant
Protein Antigen
NBP1-86692PEP
PGAP3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PGAP3 Protein (NBP1-86692PEP) (0)

There are no publications for PGAP3 Protein (NBP1-86692PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGAP3 Protein (NBP1-86692PEP) (0)

There are no reviews for PGAP3 Protein (NBP1-86692PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PGAP3 Protein (NBP1-86692PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PGAP3 Products

Blogs on PGAP3

There are no specific blogs for PGAP3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: DEC1 Antibody - BSA Free [NB100-1800] - DEC1 expression decreases in HeLa cells under apoptosis. Western blotting images of cleaved-poly (ADP-ribose) polymerase (PARP), cleaved-caspase 3, Bcl-2, DEC1, DEC2, SOX2, c-MYC and actin treated with 10, 20, and 50 uM cisplatin or mock in HeLa and SiHa cells. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33089188/) licensed under a CC-BY license.
DEC1 Antibody - BSA Free
NB100-1800
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
c-Fos Antibody (2H2)
NBP2-50037

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PGAP3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PGAP3