![Western Blot: PGAM5 Antibody (CL0624) [NBP2-52947] - Lane 1: Marker [kDa] Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/PGAM5-Antibody-CL0624-Western-Blot-NBP2-52947-img0009.jpg "Western Blot: PGAM5 Antibody (CL0624) [NBP2-52947] - Lane 1: Marker [kDa] Lane 2: Human cell line RT-4")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clone | CL0624 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV |
| Epitope | NWDRREPLSLINVRK |
| Predicted Species | Mouse (94%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PGAM5 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PGAM5 Antibody (NBP2-52947)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PGAM5 |
![Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human uterus shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PGAM5-Antibody-CL0624-Immunohistochemistry-Paraffin-NBP2-52947-img0006.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human uterus shows moderate cytoplasmic positivity in glandular cells.")
![Western Blot: PGAM5 Antibody (CL0624) [NBP2-52947] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PGAM5 antibody. Remaining relative intensity is presented. Loading control: Anti-PARP1.](http://images.novusbio.com/fullsize/PGAM5-Antibody-CL0624-Western-Blot-NBP2-52947-img0008.jpg "Western Blot: PGAM5 Antibody (CL0624) [NBP2-52947] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PGAM5 antibody. Remaining relative intensity is presented. Loading control: Anti-PARP1.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human kidney shows either strong or moderate cytoplasmic immunoreactivity in subsets of renal tubules.](http://images.novusbio.com/fullsize/PGAM5-Antibody-CL0624-Immunohistochemistry-Paraffin-NBP2-52947-img0001.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human kidney shows either strong or moderate cytoplasmic immunoreactivity in subsets of renal tubules.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human liver shows moderate cytoplasmic immunoreactivity in hepatocytes.](http://images.novusbio.com/fullsize/PGAM5-Antibody-CL0624-Immunohistochemistry-Paraffin-NBP2-52947-img0002.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human liver shows moderate cytoplasmic immunoreactivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PGAM5-Antibody-CL0624-Immunohistochemistry-Paraffin-NBP2-52947-img0003.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human testis shows moderate to strong cytoplasmic positivity in the seminiferous ducts.](http://images.novusbio.com/fullsize/PGAM5-Antibody-CL0624-Immunohistochemistry-Paraffin-NBP2-52947-img0004.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human testis shows moderate to strong cytoplasmic positivity in the seminiferous ducts.")
![Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human tonsil shows strong immunoreactivity in germinal center cells.](http://images.novusbio.com/fullsize/PGAM5-Antibody-CL0624-Immunohistochemistry-Paraffin-NBP2-52947-img0005.jpg "Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human tonsil shows strong immunoreactivity in germinal center cells.")
![Western Blot Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Western_Blot_6061.jpg)
![Simple Western Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Simple_Western_16632.jpg)
![Knockout Validated Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Knockout_Validated_23684.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0001.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0002.jpg)
![Immunohistochemistry-Paraffin MLKL [p Ser345] Antibody (JM92-37)](https://images.novusbio.com/images/MLKL-p-Ser345-Antibody-JM92-37-Immunohistochemistry-Paraffin-NBP2-66953-img0003.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")