Home » PCYT2 » PCYT2 Proteins » PCYT2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PCYT2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PCYT2 Protein (NBP1-83951PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PCYT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCYT2.

Source: E. coli

Amino Acid Sequence: TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PCYT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83951.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PCYT2 Recombinant Protein Antigen

  • CTP:phosphoethanolamine cytidylyltransferase
  • EC 2.7.7
  • EC 2.7.7.14
  • ET
  • ethanolamine-phosphate cytidylyltransferase
  • PCYT2
  • phosphate cytidylyltransferase 2, ethanolamine
  • Phosphorylethanolamine transferase

Background

ECT (ethanolamine phosphate cytidyltransferase) is an important regulatory enzyme in the pathway for phosphatidylethanolamine (PE) biosynthesis. PE functions in cell signalling, membrane fusion, platelet activation, and cell cycle progression. Specialized forms of PE exist as plasmologens, natural cannabinoid anadimade, and glycosylated PE. The ECT enzyme acts in the second of three catalysis steps to produce CDP-ethanolamine from phosphoethanolamine (P-Etn). Study of ECT could help determine the role of plasmologens in disease, specifically lipid disorders such as peroxisomal diseases as well as neuronal degeneration associated with Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC25A1 Antibody
NBP1-31851
Western Blot SLC25A1 Antibody
Western Blot SLC25A1 Antibody
Western Blot SLC25A1 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Neurophysin
II/Arg-vasopressin An ...
AF009
Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot Complement C4b/d Antibody (16D2)
(12 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(11 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Integrin alpha
2/CD49b Antibody (HAS ...
MAB1233
Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AP3B1 Antibody
NBP3-38363
Western Blot AP3B1 Antibody
Immunohistochemistry AP3B1 Antibody
Immunohistochemistry AP3B1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
EN-RAGE/S100A12
Antibody [Unconjugate
AF1052
Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]
Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]
Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]
(3 Reviews)
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
IFN-alpha/beta R1
Antibody [Unconjugate ...
AF245
Western Blot IFN-alpha/beta R1 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
NLRP3/NALP3
Antibody - BSA Free
NBP2-12446
Western Blot NLRP3/NALP3 Antibody - BSA Free
Western Blot NLRP3/NALP3 Antibody - BSA Free
Western Blot NLRP3/NALP3 Antibody - BSA Free
(4 Reviews)
(234 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Choline kinase
alpha Antibody
NBP1-85630
Western Blot Choline kinase alpha Antibody
Immunohistochemistry-Paraffin Choline kinase alpha Antibody
Immunohistochemistry-Paraffin Choline kinase alpha Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
TMEM37 Antibody
NBP2-47602
Immunocytochemistry/ Immunofluorescence TMEM37 Antibody
Immunohistochemistry-Paraffin TMEM37 Antibody
Immunohistochemistry-Paraffin TMEM37 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PCYT2 Protein (NBP1-83951PEP) (0)

There are no publications for PCYT2 Protein (NBP1-83951PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCYT2 Protein (NBP1-83951PEP) (0)

There are no reviews for PCYT2 Protein (NBP1-83951PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PCYT2 Protein (NBP1-83951PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCYT2 Products

Array NBP1-83951PEP

Research Areas for PCYT2 Protein (NBP1-83951PEP)

Find related products by research area.

Blogs on PCYT2

There are no specific blogs for PCYT2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Analysis in mouse cell lysate.
NLRP3/NALP3 Antibody - BSA Free
NBP2-12446
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PCYT2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PCYT2