PCYT2 Antibody Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
PCYT2 (NP_002852.1, 1 a.a. - 389 a.a.) full-length human protein. MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF |
Specificity |
PCYT2 - phosphate cytidylyltransferase 2, ethanolamine, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
PCYT2 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PCYT2 Antibody
Background
ECT (ethanolamine phosphate cytidyltransferase) is an important regulatory enzyme in the pathway for phosphatidylethanolamine (PE) biosynthesis. PE functions in cell signalling, membrane fusion, platelet activation, and cell cycle progression. Specialized forms of PE exist as plasmologens, natural cannabinoid anadimade, and glycosylated PE. The ECT enzyme acts in the second of three catalysis steps to produce CDP-ethanolamine from phosphoethanolamine (P-Etn). Study of ECT could help determine the role of plasmologens in disease, specifically lipid disorders such as peroxisomal diseases as well as neuronal degeneration associated with Alzheimer's disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for PCYT2 Antibody (H00005833-B01P) (0)
There are no publications for PCYT2 Antibody (H00005833-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCYT2 Antibody (H00005833-B01P) (0)
There are no reviews for PCYT2 Antibody (H00005833-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PCYT2 Antibody (H00005833-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PCYT2 Products
Research Areas for PCYT2 Antibody (H00005833-B01P)
Find related products by research area.
|
Blogs on PCYT2