Home » Paxillin » Paxillin Proteins » Paxillin Recombinant Protein Antigen

Paxillin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Paxillin Recombinant Protein Antigen (NBP2-57097PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Paxillin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Paxillin.

Source: E. coli

Amino Acid Sequence: ALNGTILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PXN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57097.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Paxillin Recombinant Protein Antigen

  • FLJ16691
  • Paxillin
  • PXN

Background

Paxillin is a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion) (1). Paxillin plays a significant role in integrin signaling and the tyrosine phosphorylation of paxillin is required for integrin-mediated cytoskeletal reorganization (2). Paxillin is phosphorylated by focal adhesion kinase (FAK) at Tyr118 (3). It has been found that phosphorylation of paxillin at both Tyr118 and Tyr31 is essential for MM1 cancer cell migration (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAK Antibody
(495919) [Unconjugate
MAB4467
Immunohistochemistry FAK Antibody (495919) [Unconjugated]
Western Blot FAK Antibody (495919) [Unconjugated]
Knockout Validated FAK Antibody (495919) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, KO, Simple Western, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
p130Cas/BCAR1
Antibody (OTI1A9)
NBP2-00532
Flow Cytometry p130Cas/BCAR1 Antibody (OTI1A9)
Flow Cytometry p130Cas/BCAR1 Antibody (OTI1A9)
Flow Cytometry p130Cas/BCAR1 Antibody (OTI1A9)
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Vinculin Antibody
(728526) [Unconjugate ...
MAB6896
Simple Western Vinculin Antibody (728526) [Unconjugated]
Western Blot Vinculin Antibody (728526) [Unconjugated]
Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
p120-catenin
Antibody (OTI2E8)
NBP2-45646
Immunohistochemistry p120-catenin Antibody (OTI2E8)
Immunohistochemistry p120-catenin Antibody (OTI2E8)
Immunohistochemistry p120-catenin Antibody (OTI2E8)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Integrin beta
1/CD29 Antibody (P5D2 ...
MAB17781
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
(36 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin RhoD Antibody
Western Blot RhoD Antibody
Immunohistochemistry RhoD Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry Rhodopsin Antibody (B630)
Western Blot Rhodopsin Antibody (B630)
Immunocytochemistry/ Immunofluorescence Rhodopsin Antibody (B630)
(10 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(63 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

CSE1L/CAS/Exportin-2 A
H00001434-M08
Western Blot CSE1L/CAS/Exportin-2 Antibody (3D8)
Immunohistochemistry-Paraffin CSE1L/CAS/Exportin-2 Antibody (3D8)
Western Blot CSE1L/CAS/Exportin-2 Antibody (3D8)
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NOLC1 Antibody
NBP3-38210
Immunocytochemistry/ Immunofluorescence NOLC1 Antibody
Western Blot NOLC1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
p130 Antibody
NBP1-82455
Immunohistochemistry-Paraffin p130 Antibody
Immunohistochemistry-Paraffin p130 Antibody
Immunohistochemistry-Paraffin p130 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RAB3GAP1 Antibody
NBP2-38206
Western Blot RAB3GAP1 Antibody
Immunohistochemistry-Paraffin RAB3GAP1 Antibody
Species: Hu
Applications: IHC, IHC-P, KD, WB
Paxillin
Recombinant Protein A
NBP2-57097PEP
Paxillin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Paxillin Recombinant Protein Antigen (NBP2-57097PEP) (0)

There are no publications for Paxillin Recombinant Protein Antigen (NBP2-57097PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Paxillin Recombinant Protein Antigen (NBP2-57097PEP) (0)

There are no reviews for Paxillin Recombinant Protein Antigen (NBP2-57097PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Paxillin Recombinant Protein Antigen (NBP2-57097PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Paxillin Products

Research Areas for Paxillin Recombinant Protein Antigen (NBP2-57097PEP)

Find related products by research area.

Blogs on Paxillin.

Check out the latest blog posts on Paxillin.
Autophagy and Metastasis
  By Christina Towers, PhD The majority of cancer patients die from metastatic disease at secondary sites. The threshold to undergo metastasis is high. Only a minority of cancer cells acquire invasive phenotypes...  Read full blog post.
CRISPR/Cas9: Keep your friends close, but your viruses closer
"CRISPR", or clustered regularly interspaced short palindromic repeats, is an ancient bacterial mechanism that prevents the invasion of foreign pathogens to a host organism.  Specifically, the CRISPR sequence has been identified as a si...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Paxillin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PXN