![Western Blot: PARD3/Par3 Antibody [NBP1-88861] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Western-Blot-NBP1-88861-img0017.jpg "Western Blot: PARD3/Par3 Antibody [NBP1-88861] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PARD3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
-(01-ml)_NBP1-88861_7161.Jpg)
Enlarge |
reviewed by:
enke baldini |
IF | Human | 04/29/2014 |
Summary
|
||||||||
Enlarge |
reviewed by:
Andrew Cosgrove |
ICC | Mouse | 11/07/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for PARD3/Par3 Antibody (NBP1-88861)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| enke baldini 04/29/2014 |
||
| Application: | IF | |
| Species: | Human |
| Andrew Cosgrove 11/07/2013 |
||
| Application: | ICC | |
| Species: | Mouse |
| Gene Symbol | PARD3 |
![Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Simple Western lane view shows a specific band for PARD3/Par3 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Simple-Western-NBP1-88861-img0009.jpg "Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Simple Western lane view shows a specific band for PARD3/Par3 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.")
![Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88861-img0016.jpg "Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining PARD3 in mouse trophoblast stem cells. Verified customer review from 1DegreeBio.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88861-img0012.jpg "Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining PARD3 in mouse trophoblast stem cells. Verified customer review from 1DegreeBio.")
![Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human colon shows distinct luminal membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunohistochemistry-Paraffin-NBP1-88861-img0014.jpg "Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human colon shows distinct luminal membranous positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. In wild-type myotubes PAR3 remains cytoplasmic. MCAM contributes to the establishment of cell autonomous polarity in myogenic and chondrogenic differentiation. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28923978/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88861-img0023.jpg "Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. In wild-type myotubes PAR3 remains cytoplasmic. MCAM contributes to the establishment of cell autonomous polarity in myogenic and chondrogenic differentiation. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28923978/) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human skin shows weak to moderate cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunohistochemistry-Paraffin-NBP1-88861-img0022.jpg "Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human skin shows weak to moderate cytoplasmic positivity in epidermal cells.")
![Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line 8505C cells (anaplastic thyroid cancer cell line). Image from verified customer review.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88861-img0013.jpg "Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line 8505C cells (anaplastic thyroid cancer cell line). Image from verified customer review.")
![Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human kidney shows weak to moderate membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunohistochemistry-Paraffin-NBP1-88861-img0019.jpg "Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human kidney shows weak to moderate membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cerebellum shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunohistochemistry-Paraffin-NBP1-88861-img0020.jpg "Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cerebellum shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human fallopian tube shows weak to moderate positivity in luminal membrane in glandular cells.](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Immunohistochemistry-Paraffin-NBP1-88861-img0021.jpg "Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human fallopian tube shows weak to moderate positivity in luminal membrane in glandular cells.")
![Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Electropherogram image(s) of corresponding Simple Western lane view. PARD3/Par3 antibody was used at 1:100 dilution on RT-4 lysate(s).](http://images.novusbio.com/fullsize/PARD3-Par3-Antibody-Simple-Western-NBP1-88861-img0015.jpg "Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Electropherogram image(s) of corresponding Simple Western lane view. PARD3/Par3 antibody was used at 1:100 dilution on RT-4 lysate(s).")
![Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. (A) In elongating myotubes (10T1/2 cells treated with testosterone for 7 days) VANGL2 is localized asymmetrically at the tip of the cell. (B) The VANGL2 enriched tip of the cell is marked by MSN. (C) In MCAM knockout C164 cells myotube elongation fails, MSN labels the whole plasma membrane & VANGL2 is spread across the cytoplasm. (D) Highly polarized localization of MCAM & SCRIB at the distal end of growing wild-type myotube. Separate channels of the boxed area are shown on the right. (E) In MCAM knockout cells SCRIB levels remain low & it is spread evenly in the cell. (F) In wild-type myotubes PAR3 remains cytoplasmic, whereas (G) in MCAM knockout C164 cells it can be detected at the cell cortex. (H) RT-qPCR demonstrates reduced expression of Scrib in MCAM mutant cell lines. Cells were treated for 7 days with BMP2 or testosterone (n=3; **P<0.01; ***P<0.001; two-tailed t-test; mean±s.e.m.). (I) Deletion of MCAM endocytosis motif leads to similar polarity defects as complete MCAM elimination. VANGL2 is evenly spread in U125 cells & PAR3 accumulates in cell cortex. (J) In chondrogenic differentiation VANGL2 was observed asymmetrically in limited number of cells. In MCAM mutant cell lines (C149, C164, U125) VANGL2 accumulated around the nucleus. (K) Initiation of myogenic (4-day culture with testosterone) & chondrogenic differentiation (4-day culture with BMP2) led to downregulation of ERK1/2 phosphorylation (p-ERK1/2). Instead in MCAM mutant cell lines ERK1/2 phosphorylation increased. Scale bars: 25 µm. Image collected & cropped by CiteAb from the following publication (//journals.biologists.com/bio/article/doi/10.1242/bio.027771/256759/MCAM-contributes-to-the-establishment-of-cell), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88861_rabbit-polyclonal-pard3-par3-antibody-310202416113535.jpg "Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. (A) In elongating myotubes (10T1/2 cells treated with testosterone for 7 days) VANGL2 is localized asymmetrically at the tip of the cell. (B) The VANGL2 enriched tip of the cell is marked by MSN. (C) In MCAM knockout C164 cells myotube elongation fails, MSN labels the whole plasma membrane & VANGL2 is spread across the cytoplasm. (D) Highly polarized localization of MCAM & SCRIB at the distal end of growing wild-type myotube. Separate channels of the boxed area are shown on the right. (E) In MCAM knockout cells SCRIB levels remain low & it is spread evenly in the cell. (F) In wild-type myotubes PAR3 remains cytoplasmic, whereas (G) in MCAM knockout C164 cells it can be detected at the cell cortex. (H) RT-qPCR demonstrates reduced expression of Scrib in MCAM mutant cell lines. Cells were treated for 7 days with BMP2 or testosterone (n=3; **P<0.01; ***P<0.001; two-tailed t-test; mean±s.e.m.). (I) Deletion of MCAM endocytosis motif leads to similar polarity defects as complete MCAM elimination. VANGL2 is evenly spread in U125 cells & PAR3 accumulates in cell cortex. (J) In chondrogenic differentiation VANGL2 was observed asymmetrically in limited number of cells. In MCAM mutant cell lines (C149, C164, U125) VANGL2 accumulated around the nucleus. (K) Initiation of myogenic (4-day culture with testosterone) & chondrogenic differentiation (4-day culture with BMP2) led to downregulation of ERK1/2 phosphorylation (p-ERK1/2). Instead in MCAM mutant cell lines ERK1/2 phosphorylation increased. Scale bars: 25 µm. Image collected & cropped by CiteAb from the following publication (//journals.biologists.com/bio/article/doi/10.1242/bio.027771/256759/MCAM-contributes-to-the-establishment-of-cell), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. (A) In elongating myotubes (10T1/2 cells treated with testosterone for 7 days) VANGL2 is localized asymmetrically at the tip of the cell. (B) The VANGL2 enriched tip of the cell is marked by MSN. (C) In MCAM knockout C164 cells myotube elongation fails, MSN labels the whole plasma membrane & VANGL2 is spread across the cytoplasm. (D) Highly polarized localization of MCAM & SCRIB at the distal end of growing wild-type myotube. Separate channels of the boxed area are shown on the right. (E) In MCAM knockout cells SCRIB levels remain low & it is spread evenly in the cell. (F) In wild-type myotubes PAR3 remains cytoplasmic, whereas (G) in MCAM knockout C164 cells it can be detected at the cell cortex. (H) RT-qPCR demonstrates reduced expression of Scrib in MCAM mutant cell lines. Cells were treated for 7 days with BMP2 or testosterone (n=3; **P<0.01; ***P<0.001; two-tailed t-test; mean±s.e.m.). (I) Deletion of MCAM endocytosis motif leads to similar polarity defects as complete MCAM elimination. VANGL2 is evenly spread in U125 cells & PAR3 accumulates in cell cortex. (J) In chondrogenic differentiation VANGL2 was observed asymmetrically in limited number of cells. In MCAM mutant cell lines (C149, C164, U125) VANGL2 accumulated around the nucleus. (K) Initiation of myogenic (4-day culture with testosterone) & chondrogenic differentiation (4-day culture with BMP2) led to downregulation of ERK1/2 phosphorylation (p-ERK1/2). Instead in MCAM mutant cell lines ERK1/2 phosphorylation increased. Scale bars: 25 µm. Image collected & cropped by CiteAb from the following publication (//journals.biologists.com/bio/article/doi/10.1242/bio.027771/256759/MCAM-contributes-to-the-establishment-of-cell), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88861_rabbit-polyclonal-pard3-par3-antibody-310202416113539.jpg "Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. (A) In elongating myotubes (10T1/2 cells treated with testosterone for 7 days) VANGL2 is localized asymmetrically at the tip of the cell. (B) The VANGL2 enriched tip of the cell is marked by MSN. (C) In MCAM knockout C164 cells myotube elongation fails, MSN labels the whole plasma membrane & VANGL2 is spread across the cytoplasm. (D) Highly polarized localization of MCAM & SCRIB at the distal end of growing wild-type myotube. Separate channels of the boxed area are shown on the right. (E) In MCAM knockout cells SCRIB levels remain low & it is spread evenly in the cell. (F) In wild-type myotubes PAR3 remains cytoplasmic, whereas (G) in MCAM knockout C164 cells it can be detected at the cell cortex. (H) RT-qPCR demonstrates reduced expression of Scrib in MCAM mutant cell lines. Cells were treated for 7 days with BMP2 or testosterone (n=3; **P<0.01; ***P<0.001; two-tailed t-test; mean±s.e.m.). (I) Deletion of MCAM endocytosis motif leads to similar polarity defects as complete MCAM elimination. VANGL2 is evenly spread in U125 cells & PAR3 accumulates in cell cortex. (J) In chondrogenic differentiation VANGL2 was observed asymmetrically in limited number of cells. In MCAM mutant cell lines (C149, C164, U125) VANGL2 accumulated around the nucleus. (K) Initiation of myogenic (4-day culture with testosterone) & chondrogenic differentiation (4-day culture with BMP2) led to downregulation of ERK1/2 phosphorylation (p-ERK1/2). Instead in MCAM mutant cell lines ERK1/2 phosphorylation increased. Scale bars: 25 µm. Image collected & cropped by CiteAb from the following publication (//journals.biologists.com/bio/article/doi/10.1242/bio.027771/256759/MCAM-contributes-to-the-establishment-of-cell), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Flow Cytometry PAR2 Antibody (344222) [Unconjugated]](https://images.novusbio.com/images2/PAR2_MAB3949_Flow_Cytometry_8427.jpg)
![Flow Cytometry PAR2 Antibody (344222) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3949_human-par2-mab-clone-344222-flow-cytometry-512024112636..jpg)
![N/A AgRP/ART [HRP]](https://images.novusbio.com/images2/DATA_AgRP_DAGR00_ELISA_569.jpg)
![N/A AgRP/ART [HRP]](https://images.novusbio.com/images2/DATA_AgRP_DAGR00_ELISA_570.jpg)
![N/A AgRP/ART [HRP]](https://images.novusbio.com/images2/AgRP_DAGR00_ELISA_27.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
-(01-ml)_NBP1-88861_7161.Jpg)
