Home » PAIP2 » PAIP2 Proteins » PAIP2 Recombinant Protein Antigen

PAIP2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PAIP2 Protein (NBP1-80954PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

PAIP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAIP2.

Source: E. coli

Amino Acid Sequence: IPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAIP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80954.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PAIP2 Recombinant Protein Antigen

  • MGC72018
  • PABC1-interacting protein 2
  • PABP-interacting protein 2
  • PAIP-2
  • PAIP2APoly(A)-binding protein-interacting protein 2
  • poly(A) binding protein interacting protein 2
  • polyA-binding protein-interacting protein 2
  • polyadenylate-binding protein-interacting protein 2

Background

PAIP2, also known as Poly(A)-binding protein-interacting protein 2, acts as a repressor in the regulation of translation initiation of poly(A)-containing mRNAs. Its inhibitory activity on translation is mediated via its action on PABPC1. It displaces the interaction of PABPC1 with poly(A) RNA and competes with PAIP1 for binding to PABPC1. Its association with PABPC1 results in disruption of the cytoplasmic poly(A) RNP structure organization. Recombinant PAIP2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PABP Antibody
(10E10) - BSA Free
NB120-6125
Flow Cytometry PABP Antibody (10E10) - BSA Free
Western Blot PABP Antibody (10E10) - BSA Free
Western Blot PABP Antibody (10E10) - BSA Free
(1 Review)
(11 Publications)
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
PAIP1 Antibody
(2D11)
H00010605-M04
Immunocytochemistry/ Immunofluorescence PAIP1 Antibody (2D11)
Sandwich ELISA PAIP1 Antibody (2D11)
Western Blot PAIP1 Antibody (2D11)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
eIF4A2 Antibody
NBP2-24529
Western Blot eIF4A2 Antibody
Immunohistochemistry-Paraffin eIF4A2 Antibody
Simple Western eIF4A2 Antibody
(1 Review)
(1 Publication)
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
UBR5/EDD Antibody
NB100-1591
Immunohistochemistry-Paraffin UBR5/EDD Antibody
Immunohistochemistry-Paraffin UBR5/EDD Antibody
Western Blot UBR5/EDD Antibody
(10 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
PAIP2B Antibody
NBP2-30969
Immunohistochemistry-Paraffin PAIP2B Antibody
Species: Hu
Applications: IHC, IHC-P
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(685 Publications)
Species: Hu
Applications: ELISA
eIF4A1 Antibody
NBP2-24632
Western Blot eIF4A1 Antibody
Immunohistochemistry-Paraffin eIF4A1 Antibody
Western Blot eIF4A1 Antibody
(2 Publications)
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Ataxin-2 Antibody
NBP1-90063
Immunocytochemistry/ Immunofluorescence Ataxin-2 Antibody
Immunohistochemistry-Paraffin Ataxin-2 Antibody
Immunohistochemistry-Paraffin Ataxin-2 Antibody
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
4EBP1 Antibody
NB200-157
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
Kallikrein 1
Antibody (323803) [Un ...
MAB2337
Kallikrein 1 Antibody (323803) [Unconjugated]
(1 Review)
Species: Hu
Applications: IP, WB
PIWIL1/HIWI
Antibody
AF6548
Immunohistochemistry PIWIL1/HIWI Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC

Publications for PAIP2 Protein (NBP1-80954PEP) (0)

There are no publications for PAIP2 Protein (NBP1-80954PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAIP2 Protein (NBP1-80954PEP) (0)

There are no reviews for PAIP2 Protein (NBP1-80954PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PAIP2 Protein (NBP1-80954PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAIP2 Products

Blogs on PAIP2

There are no specific blogs for PAIP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PAIP2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PAIP2