Home » PAF49 » PAF49 Proteins » PAF49 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PAF49 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PAF49 Protein (NBP1-90084PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PAF49 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD3EAP.

Source: E. coli

Amino Acid Sequence: GNPPVTGPRSALAPNLLTSGKKKKEMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVRKKKKKKNQQLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKKRKKPKGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD3EAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90084.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PAF49 Recombinant Protein Antigen

  • A34.5
  • antisense to ERCC 1
  • Antisense to ERCC-1 protein
  • ASE-1ASE1
  • CASTMGC118851
  • CD3 epsilon associated protein
  • CD3e antigen, epsilon polypeptide associated protein
  • CD3e molecule, epsilon associated protein
  • CD3E-associated protein
  • CD3-epsilon-associated protein
  • DNA-directed RNA polymerase I subunit RPA34
  • PAF49RNA polymerase I-associated factor PAF49

Background

PAF49/CAST is subunit of RNA polymerase I. PAF49/CAST has been shown to interact with activator upstream binding factor (UBF) and plays an important role in rDNA transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TTF2 Antibody (1E8)
H00008458-M06
Immunocytochemistry/ Immunofluorescence TTF2 Antibody (1E8)
Western Blot TTF2 Antibody (1E8)
Western Blot TTF2 Antibody (1E8)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ELKS Antibody
NBP1-88177
Western Blot ELKS Antibody
Immunohistochemistry-Paraffin ELKS Antibody
Western Blot ELKS Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
iASPP Antibody
NBP2-48732
Immunocytochemistry/ Immunofluorescence iASPP Antibody
Western Blot iASPP Antibody
Immunohistochemistry-Paraffin iASPP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
RIMS1 Antibody
NBP3-13395
Western Blot RIMS1 Antibody
Species: Mu, Rt
Applications: WB
ERCC1 Antibody
(8F1) - BSA Free
NB500-704
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
(1 Review)
(17 Publications)
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Calpain 1 Antibody
NBP2-15671
Immunoprecipitation Calpain 1 Antibody
Western Blot Calpain 1 Antibody
Immunohistochemistry-Paraffin Calpain 1 Antibody
(1 Publication)
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
Bassoon Antibody
(SAP7F407)
NB120-13249
Western Blot Bassoon Antibody (SAP7F407)
Immunohistochemistry Bassoon Antibody (SAP7F407)
Immunocytochemistry/ Immunofluorescence Bassoon Antibody (SAP7F407)
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Uromodulin
Antibody [Unconjugate
AF5175
Western Blot Uromodulin Antibody [Unconjugated]
Immunohistochemistry Uromodulin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]
(8 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
RPS19 Antibody
NB100-2452
Western Blot RPS19 Antibody
Immunohistochemistry-Paraffin RPS19 Antibody
Immunohistochemistry-Paraffin RPS19 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
ATN1 Antibody
NBP1-90044
Immunocytochemistry/ Immunofluorescence ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Bassoon Antibody
(SAP7F407)
NB120-13249
Western Blot Bassoon Antibody (SAP7F407)
Immunohistochemistry Bassoon Antibody (SAP7F407)
Immunocytochemistry/ Immunofluorescence Bassoon Antibody (SAP7F407)
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CtBP1 Antibody
(2G7)
H00001487-M01
Western Blot CtBP1 Antibody (2G7)
Immunocytochemistry/ Immunofluorescence CtBP1 Antibody (2G7)
Immunohistochemistry-Paraffin CtBP1 Antibody (2G7)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
BAAT Antibody -
BSA Free
NBP2-92503
Western Blot BAAT Antibody - BSA Free
Immunohistochemistry-Paraffin BAAT Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence BAAT Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
XPD Antibody
AF3296
Western Blot XPD Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
UBTF Antibody
NBP1-82545
Immunocytochemistry/ Immunofluorescence UBTF Antibody
Western Blot UBTF Antibody
Immunohistochemistry-Paraffin UBTF Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
ABR Antibody
NBP1-30981
Immunocytochemistry/ Immunofluorescence ABR Antibody
Western Blot ABR Antibody
Western Blot ABR Antibody
Species: Hu, Mu
Applications: ICC/IF, WB
PAF49 Recombinant
Protein Antigen
NBP1-90084PEP
PAF49 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PAF49 Protein (NBP1-90084PEP) (0)

There are no publications for PAF49 Protein (NBP1-90084PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAF49 Protein (NBP1-90084PEP) (0)

There are no reviews for PAF49 Protein (NBP1-90084PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PAF49 Protein (NBP1-90084PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAF49 Products

Blogs on PAF49

There are no specific blogs for PAF49, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Anti-ERCC1 immunohistochemistry on whole sections of a lung squamous cell carcinoma, using Mab 8F1 and D-10 with CC1-mono and H2-60 protocols. Note increased cytosolic background with H2-60. Arrow: Necrotic centre. Arrowhead: Stromal axis. 100 A- original magnification. Image collected and cropped by Citeab from the following publication (Automated ERCC1 immunochemistry on hybrid cytology/tissue microarray of malignant effusions: evaluation of antibodies 8F1 and D-10. J Clin Bioinforma (2011) licensed under a CC-BY license.
ERCC1 Antibody (8F1) - BSA Free
NB500-704

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PAF49 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CD3EAP