P4HA1 Recombinant Protein Antigen

Name: P4HA1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84397PEP
Price: 279 USD

Images

There are currently no images for P4HA1 Protein (NBP1-84397PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

P4HA1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P4HA1. Source: E. coli Amino Acid Sequence: FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	P4HA1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84397. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for P4HA1 Recombinant Protein Antigen

2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase)
2-oxoglutarate-4-dioxygenase subunit alpha-1
4-PH Alpha-1
alpha polypeptide I
EC 1.14.11.2
P4HA
P4HA1
Procollagen-proline
prolyl 4-hydroxylase, alpha polypeptide I

Background

P4HA1 encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

P4HA2 Antibody -
BSA Free

NBP2-33878

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

ERK1 Antibody
(1E5) - BSA Free

NBP2-22203

Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free

Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free

(1 Publication)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

HIF-1 alpha
Antibody (H1alpha67)

NB100-105

Flow Cytometry HIF-1 alpha Antibody (H1alpha67)

(45 Reviews)

(1059 Publications)

Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp

Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(824 Publications)

Species: Hu

Applications: BA

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

TGF-beta RIII
Antibody [Unconjugate

AF-242-PB

Immunohistochemistry TGF-beta RIII Antibody [Unconjugated]

(18 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, IHC, WB

VEGF [HRP]

DVE00

(686 Publications)

Species: Hu

Applications: ELISA

TGF-beta 1
[Unconjugated]

7754-BH/CF

(53 Publications)

Species: Hu

Applications: BA

IL-6 [HRP]

M6000B

(676 Publications)

Species: Mu

Applications: ELISA

LOX Antibody - BSA
Free

NB100-2527

Immunohistochemistry LOX Antibody - BSA Free

(5 Reviews)

(39 Publications)

Species: Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB

Collagen II
Antibody (5B2.5) - BS

NB600-844

Western Blot Collagen II Antibody (5B2.5) - BSA Free

(53 Publications)

Species: Ch, Hu, Mu, Rb, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

IGFBP-6 Antibody
(110211)

MAB8761

(5 Publications)

Species: Hu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB

HYPB Antibody -
Azide and BSA Free

NBP3-03807

Western Blot HYPB Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IP, WB

PLOD1 Antibody -
BSA Free

NBP2-38770

(3 Publications)

Species: Hu, Mu

Applications: IHC-P, WB

P4HA3 Antibody -
BSA Free

NBP1-84396

(1 Review)

Species: Hu

Applications: IHC, IHC-P

Adrenomedullin/ADM
Antibody [Unconjugate ...

AF6108

(1 Publication)

Species: Hu

Applications: IHC

Park7/DJ-1
Antibody - BSA Free

NB300-270

Western Blot Park7/DJ-1 Antibody - BSA Free

(3 Reviews)

(23 Publications)

Species: Ch, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB

Protein Disulfide
Isomerase/P4HB Antibo ...

NB300-517

Immunocytochemistry/ Immunofluorescence Protein Disulfide Isomerase/P4HB Antibody (RL90)

(3 Reviews)

(28 Publications)

Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt

Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB

EGLN1/PHD2
Antibody - BSA Free

NB100-137

Western Blot EGLN1/PHD2 Antibody - BSA Free

Immunohistochemistry EGLN1/PHD2 Antibody - BSA Free

(12 Reviews)

(93 Publications)

Species: Hu, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, KD, KO, Simple Western, WB

P4HA1 Recombinant
Protein Antigen

NBP1-84397PEP

Species: Hu

Applications: AC

Publications for P4HA1 Protein (NBP1-84397PEP) (0)

There are no publications for P4HA1 Protein (NBP1-84397PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P4HA1 Protein (NBP1-84397PEP) (0)

There are no reviews for P4HA1 Protein (NBP1-84397PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for P4HA1 Protein (NBP1-84397PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P4HA1 Products

Blogs on P4HA1

There are no specific blogs for P4HA1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.

HIF-1 alpha Antibody (H1alpha67)
NB100-105

Immunohistochemistry-Paraffin: P4HA1 Antibody [NBP1-84398] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.

P4HA1 Antibody - BSA Free
NBP1-84398

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our P4HA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

P4HA1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

P4HA1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

P4HA1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for P4HA1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for P4HA1 Protein (NBP1-84397PEP) (0)

Reviews for P4HA1 Protein (NBP1-84397PEP) (0)

FAQs for P4HA1 Protein (NBP1-84397PEP) (0)

Additional P4HA1 Products

Blogs on P4HA1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics