![Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining in human cerebral cortex and liver tissues . Corresponding P2RY12 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Immunohistochemistry-Paraffin-NBP2-33870-img0014.jpg "Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining in human cerebral cortex and liver tissues . Corresponding P2RY12 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Ca, FeSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | P2RY12 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Helena Morrison |
Immunohistochemistry-Fixed; cryoprotected | Mouse | 02/07/2020 |
Summary
Comments
|
||||||||||
|
reviewed by:
Verified Customer |
IHC-Fr | Canine | 08/07/2018 |
Summary
|
|||||||||||
Enlarge |
reviewed by:
Verified Customer |
ICC | Feline | 05/11/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for P2Y12/P2RY12 Antibody (NBP2-33870)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Helena Morrison 02/07/2020 |
||
| Application: | Immunohistochemistry-Fixed; cryoprotected | |
| Species: | Mouse |
| Verified Customer 08/07/2018 |
||
| Application: | IHC-Fr | |
| Species: | Canine |
| Verified Customer 05/11/2017 |
||
| Application: | ICC | |
| Species: | Feline |
| Gene Symbol | P2RY12 |
![Western Blot: P2Y12/P2RY12 Antibody [NBP2-33870] - Quantitative biochemical measurements of P2Y12/P2RY12 protein and mRNA in human brains. Western blot measurements of P2Y12/P2RY12 levels in MTG samples from LP, HP and AD brains. Representative western blot image of P2Y12/P2RY12 polypeptide of MTG protein extracts identified with Novus antibody. Blots were normalized for levels of beta actin. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/21/2/678), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Western-Blot-NBP2-33870-img0018.jpg "Western Blot: P2Y12/P2RY12 Antibody [NBP2-33870] - Quantitative biochemical measurements of P2Y12/P2RY12 protein and mRNA in human brains. Western blot measurements of P2Y12/P2RY12 levels in MTG samples from LP, HP and AD brains. Representative western blot image of P2Y12/P2RY12 polypeptide of MTG protein extracts identified with Novus antibody. Blots were normalized for levels of beta actin. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/21/2/678), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: P2Y12/P2RY12 Antibody [NBP2-33870] - Green-P2Y12/P2RY12, Blue-DAPI. 1:200 dilution for fixed tissue sections of feline optical nerve. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33870-img0011.jpg "Immunocytochemistry/Immunofluorescence: P2Y12/P2RY12 Antibody [NBP2-33870] - Green-P2Y12/P2RY12, Blue-DAPI. 1:200 dilution for fixed tissue sections of feline optical nerve. ICC/IF image submitted by a verified customer review.")
![Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] - Features of P2Y12/P2RY12-immunoreactive microglia. (I,J). Staining of representative sections with P2Y12/P2RY12 (Novus) antibody preabsorbed with immunizing peptide (I, +Pep) compared to staining of matched section with P2Y12/P2RY12 antibody non-absorbed (J, -Pep). (K,L). Staining of matched sections with alternative P2Y12/P2RY12 antibody. Same staining pattern of microglia revealed with P2Y12/P2RY12 (Novus) antibody (C) as with P2Y12/P2RY12 (Alomone Labs) antibody. All sections shown had been counterstained with neutral red to identify nuclei (red color). Abbreviations: ND: non-demented. AD: Alzheimer's disease. MTG: middle temporal gyrus.-Pep: antibody without immunizing peptide. + Pep: antibody with immunizing peptide. Scale bars represent 50 um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/21/2/678), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Immunohistochemistry-NBP2-33870-img0019.jpg "Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] - Features of P2Y12/P2RY12-immunoreactive microglia. (I,J). Staining of representative sections with P2Y12/P2RY12 (Novus) antibody preabsorbed with immunizing peptide (I, +Pep) compared to staining of matched section with P2Y12/P2RY12 antibody non-absorbed (J, -Pep). (K,L). Staining of matched sections with alternative P2Y12/P2RY12 antibody. Same staining pattern of microglia revealed with P2Y12/P2RY12 (Novus) antibody (C) as with P2Y12/P2RY12 (Alomone Labs) antibody. All sections shown had been counterstained with neutral red to identify nuclei (red color). Abbreviations: ND: non-demented. AD: Alzheimer's disease. MTG: middle temporal gyrus.-Pep: antibody without immunizing peptide. + Pep: antibody with immunizing peptide. Scale bars represent 50 um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/21/2/678), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Immunohistochemistry-Paraffin-NBP2-33870-img0012.jpg "Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.")
![Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human liver shows no positivity as expected.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Immunohistochemistry-Paraffin-NBP2-33870-img0013.jpg "Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human liver shows no positivity as expected.")
![Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Immunohistochemistry-Paraffin-NBP2-33870-img0016.jpg "Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebellum shows strong cytoplasmic positivity in microglia.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Immunohistochemistry-Paraffin-NBP2-33870-img0017.jpg "Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebellum shows strong cytoplasmic positivity in microglia.")
![Immunohistochemistry-Frozen: P2Y12/P2RY12 Antibody [NBP2-33870] - Canine optic nerve. Immunofluorescent signal was detected using Alexa Fluor 488 conjugated secondary antibody (green). IHC-Fr image submitted by a verified customer review.](http://images.novusbio.com/fullsize/P2Y12-P2RY12-Antibody-Immunohistochemistry-Frozen-NBP2-33870-img0015.jpg "Immunohistochemistry-Frozen: P2Y12/P2RY12 Antibody [NBP2-33870] - Canine optic nerve. Immunofluorescent signal was detected using Alexa Fluor 488 conjugated secondary antibody (green). IHC-Fr image submitted by a verified customer review.")
![Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] - Images demonstrating colocalization of CD105/MAB1097 with microglial markers (a) panels A, B Low magnification images of high-plaque (HP) case (panel A) & AD case (panel B) showing staining with CD105/MAB1097 (purple arrows) & IBA-1 (brown arrows) in MTG sections. Both images at same magnification: scale bars represent 100 μm. (b) (panel A) CD105 microglia (purple arrows) with ramified morphology stained with antibody to P2RY12 (brown arrow) in low-plaque (LP) case. (panel B) CD105 microglia (purple arrows) & HLA-DR (brown arrow) in AD case. (panel C) CD105 microglia (purple arrow) & CD45 (brown arrow) in AD case. All sections were from MTG. Images at same magnification: scale bars represent 50 μm. (c) (panel A–E). Patterns of staining of CD105 (purple) & IBA-1 (brown) in MTG sections of cases with progressively increasing pathology from LP to AD. (panel F). CD105-positive microglia in hippocampus (HPC) of AD case. Images at same magnification: scale bars represent 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31340569), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33870_rabbit-p2y12-p2ry12-pab-310202416114763.jpg "Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] - Images demonstrating colocalization of CD105/MAB1097 with microglial markers (a) panels A, B Low magnification images of high-plaque (HP) case (panel A) & AD case (panel B) showing staining with CD105/MAB1097 (purple arrows) & IBA-1 (brown arrows) in MTG sections. Both images at same magnification: scale bars represent 100 μm. (b) (panel A) CD105 microglia (purple arrows) with ramified morphology stained with antibody to P2RY12 (brown arrow) in low-plaque (LP) case. (panel B) CD105 microglia (purple arrows) & HLA-DR (brown arrow) in AD case. (panel C) CD105 microglia (purple arrow) & CD45 (brown arrow) in AD case. All sections were from MTG. Images at same magnification: scale bars represent 50 μm. (c) (panel A–E). Patterns of staining of CD105 (purple) & IBA-1 (brown) in MTG sections of cases with progressively increasing pathology from LP to AD. (panel F). CD105-positive microglia in hippocampus (HPC) of AD case. Images at same magnification: scale bars represent 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31340569), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Intracellular Staining by Flow Cytometry Serpin A5/Protein C Inhibitor Antibody (210326) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1266_human-serpin-a5-mab-clone-210326-intracellular-staining-by-flow-cytometry-662020192248.jpg)
![SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_695.jpg)
![Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_697.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/CD40_Ligand_DCDL40_ELISA_60.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/DATA_CD40_Ligand_DCDL40_ELISA_624.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
