Home » OXSM » OXSM Proteins » OXSM Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

OXSM Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for OXSM Protein (NBP1-84730PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

OXSM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OXSM.

Source: E. coli

Amino Acid Sequence: SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OXSM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84730.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OXSM Recombinant Protein Antigen

  • 3-ketoacyl-acyl carrier protein synthase
  • 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
  • 3-oxoacyl-ACP synthase, mitochondrial
  • acyl-malonyl acyl carrier protein-condensing enzyme
  • beta-ketoacyl synthase
  • Beta-ketoacyl-ACP synthase
  • EC 2.3.1
  • EC 2.3.1.41
  • FASN2D
  • FLJ20604
  • KASI
  • KS3-oxoacyl-acyl-carrier-protein synthase
  • type II mitochondrial beta-ketoacyl synthase

Background

OXSM is a mitochondrial beta-ketoacyl synthase (EC 2.3.1.41) involved in mitochondrial fatty acid synthesis. It is required for catalysis of the chain-elongating condensation reaction (Zhang et al., 2005 [PubMed 15668256]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kv7.1 Antibody
(S37A/10)
NBP2-12897
Immunohistochemistry Kv7.1 Antibody (S37A/10)
Western Blot Kv7.1 Antibody (S37A/10)
Immunohistochemistry Kv7.1 Antibody (S37A/10)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
KCNE1 Antibody
(5B12)
H00003753-M01
ELISA KCNE1 Antibody (5B12)
Western Blot KCNE1 Antibody (5B12)
Western Blot KCNE1 Antibody (5B12)
(4 Publications)
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Kv11.1 Antibody -
Azide and BSA Free
NBP3-03109
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Western Blot Kv11.1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Cytokeratin, pan
Antibody (AE-1/AE-3)
NBP2-29429
Dual RNAscope ISH-IHC Cytokeratin, pan Antibody (AE-1/AE-3)
CyTOF-reported Cytokeratin, pan Antibody (AE-1/AE-3)
Flow Cytometry Cytokeratin, pan Antibody (AE-1/AE-3)
(1 Review)
(59 Publications)
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(27 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(637 Publications)
Species: Mu
Applications: ELISA
A-RAF Antibody
(OTI2G9)
NBP2-46538
Immunohistochemistry A-RAF Antibody (OTI2G9)
Immunohistochemistry A-RAF Antibody (OTI2G9)
Immunohistochemistry A-RAF Antibody (OTI2G9)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aggrecan Neoepitope Antibody - BSA Free
(32 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
DHPS Antibody
NBP1-82648
Immunocytochemistry/ Immunofluorescence DHPS Antibody
Western Blot DHPS Antibody
Immunohistochemistry-Paraffin DHPS Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAP4K6 Antibody
NBP1-22990
Western Blot MAP4K6 Antibody
(5 Publications)
Species: Hu, Mu
Applications: IP, WB
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-87964
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Peripherin 2/PRPH2
Antibody
NBP1-86687
Western Blot Peripherin 2/PRPH2 Antibody
Immunohistochemistry-Paraffin Peripherin 2/PRPH2 Antibody
Immunohistochemistry-Paraffin Peripherin 2/PRPH2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
NDUFAB1 Antibody
NBP2-33710
Immunohistochemistry-Paraffin NDUFAB1 Antibody
Immunocytochemistry/ Immunofluorescence NDUFAB1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(674 Publications)
Species: Hu
Applications: ELISA

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Immunocytochemistry/ Immunofluorescence N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
OXSM Recombinant
Protein Antigen
NBP1-84730PEP
OXSM Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for OXSM Protein (NBP1-84730PEP) (0)

There are no publications for OXSM Protein (NBP1-84730PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OXSM Protein (NBP1-84730PEP) (0)

There are no reviews for OXSM Protein (NBP1-84730PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OXSM Protein (NBP1-84730PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OXSM Products

Blogs on OXSM

There are no specific blogs for OXSM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OXSM Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol OXSM