![Immunocytochemistry/Immunofluorescence: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli.](http://images.novusbio.com/fullsize/Nucleoplasmin-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13673-img0007.jpg "Immunocytochemistry/Immunofluorescence: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: GSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPM2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPM2 |
![Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining in human parathyroid gland and liver tissues using anti-NPM2 antibody. Corresponding NPM2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Nucleoplasmin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-13673-img0006.jpg "Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining in human parathyroid gland and liver tissues using anti-NPM2 antibody. Corresponding NPM2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/Nucleoplasmin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-13673-img0004.jpg "Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/Nucleoplasmin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-13673-img0005.jpg "Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human parathyroid gland shows high expression.")
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![Western Blot TACC3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TACC3_AF5720_Western_Blot_5818.jpg)
![Simple Western TACC3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TACC3_AF5720_Simple_Western_17066.jpg)
![Western Blot SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD-1_AF7550_Western_Blot_12344.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD1_AF7550_Knockout_Validated_24050.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af7550_human-scd-1-affinity-purified-polyclonal-ab-20820241518560.png)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")