NTS2/NTSR2 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of NTS2/NTSR2. Peptide sequence: AFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTF The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NTSR2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for NTS2/NTSR2 Antibody
Background
Official Gene Symbol: NTSR2 Gen Bank Accession Number: NP_036476 Gene ID: 23620 (Human) Gene Map Locus: 2p25.1 (Human) NTR2 is a member of GPCR family. It contains a short N-terminal sequence, 7 transmembrane domains and a short cytoplasmic tail. It is a low affinity levocabastine-sensitive receptor for Neurotensin. Activation of NT2R by non-peptide agonists suggests that the receptor can couple to phospholipase C, phospholipase A2 and MAPK. Unlike NTR1, NTR2 is insensitive to GTP and has low sensitivity of sodium ions. Northern Blot analysis detected its expression in adult brain regions including the olfactory system, cerebral and crebellar cortices, hippocampus and hypothalamic nuclei. Its expression has also been found in low levels in kidney, uterus, heart and lung.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: WB
Publications for NTS2/NTSR2 Antibody (NBP2-84195) (0)
There are no publications for NTS2/NTSR2 Antibody (NBP2-84195).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NTS2/NTSR2 Antibody (NBP2-84195) (0)
There are no reviews for NTS2/NTSR2 Antibody (NBP2-84195).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NTS2/NTSR2 Antibody (NBP2-84195) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NTS2/NTSR2 Products
Research Areas for NTS2/NTSR2 Antibody (NBP2-84195)
Find related products by research area.
|
Blogs on NTS2/NTSR2