Reactivity | Hu, MuSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to NPY1R(neuropeptide Y receptor Y1) The peptide sequence was selected from the middle region of NPY1R. Peptide sequence TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | NPY1R |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Theoretical MW | 44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Publications using NBP1-59008 | Applications | Species |
---|---|---|
Gheller BJ, Blum JE, Merritt EK et al. Peptide YY (PYY) Is Expressed in Human Skeletal Muscle Tissue and Expanding Human Muscle Progenitor Cells Front Physiol 2019-03-05 [PMID: 30890955] (WB, Human) | WB | Human |
Gheller BJF Metabolic and Transcriptional Regulation of Muscle Stem Cell State Transition Thesis 2020-01-01 | ||
Bhat R, Thangavel H, Abdulkareem NM et al. NPY1R exerts inhibitory action on estradiol-stimulated growth and predicts endocrine sensitivity and better survival in ER-positive breast cancer Scientific reports 2022-02-04 [PMID: 35121782] (WB, Human) | WB | Human |
Sun WW, ShangGuan T, Zhu P et al. Role of hepatic neuropeptide Y-Y1 receptors in a methionine-choline-deficient model of non-alcoholic steatohepatitis Life Sci 2020-01-29 [PMID: 31991181] |
Secondary Antibodies |
Isotype Controls |
Research Areas for NPY1R Antibody (NBP1-59008)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.