![Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Analysis in human colon and liver tissues using NBP1-80865 antibody. Corresponding Peptide YY RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Peptide-YY-Antibody-Immunohistochemistry-Paraffin-NBP1-80865-img0007.jpg "Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Analysis in human colon and liver tissues using NBP1-80865 antibody. Corresponding Peptide YY RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PYY |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-80865 | Applications | Species |
|---|---|---|
| Olivieri, M, M Charting the genetic architecture of the DNA damage response in human cells Thesis 2022-01-01 (WB, Human) | WB | Human |
| Das S, Parray H, Chiranjivi A et al. Kennedy epitope (KE)-dependent retrograde transport of efficiently cleaved HIV-1 envelopes (Envs) and its effect on Env cell surface expression and viral particle formation Research Square 2022-11-10 (WB, Human) | WB | Human |
| Gurrado A, Giungato S, Catacchio I et al. Jejunal overexpression of peptide YY in celiac disease complicated with pneumatosis cystoides intestinalis. Clin. Exp. Med. 2014-10-08 [PMID: 25291987] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Peptide YY Antibody (NBP1-80865)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/Peptide-YY-Antibody-Immunohistochemistry-Paraffin-NBP1-80865-img0004.jpg "Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Staining of human rectum shows high expression.](http://images.novusbio.com/fullsize/Peptide-YY-Antibody-Immunohistochemistry-Paraffin-NBP1-80865-img0005.jpg "Immunohistochemistry-Paraffin: Peptide YY Antibody [NBP1-80865] - Staining of human rectum shows high expression.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Immunohistochemistry GIP Antibody (911205) [Unconjugated]](https://images.novusbio.com/images2/GIP_MAB8864_Immunohistochemistry_17088.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")