![Western Blot: NOS1AP Antibody [NBP2-38151] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/NOS1AP-Antibody-Western-Blot-NBP2-38151-img0003.jpg "Western Blot: NOS1AP Antibody [NBP2-38151] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVK |
| Predicted Species | Mouse (95%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NOS1AP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP2-38151 | Applications | Species |
|---|---|---|
| Majmundar AJ, Buerger F, Forbes TA, et al. Recessive NOS1AP variants impair actin remodeling and cause glomerulopathy in humans and mice Science advances 2021-01-01 [PMID: 33523862] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: NOS1AP Antibody [NBP2-38151] - Staining of human cell line A-431 shows positivity in nucleus and vesicles.](http://images.novusbio.com/fullsize/NOS1AP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38151-img0001.jpg "Immunocytochemistry/Immunofluorescence: NOS1AP Antibody [NBP2-38151] - Staining of human cell line A-431 shows positivity in nucleus and vesicles.")
![Immunohistochemistry-Paraffin: NOS1AP Antibody [NBP2-38151] - Staining of human kidney shows moderate cytoplasmic positivity in cells in distal tubules.](http://images.novusbio.com/fullsize/NOS1AP-Antibody-Immunohistochemistry-Paraffin-NBP2-38151-img0007.jpg "Immunohistochemistry-Paraffin: NOS1AP Antibody [NBP2-38151] - Staining of human kidney shows moderate cytoplasmic positivity in cells in distal tubules.")
![Immunohistochemistry-Paraffin: NOS1AP Antibody [NBP2-38151] - Staining of human Cerebral cortex shows very weak cytoplasmic positivity in neuronal cells](http://images.novusbio.com/fullsize/NOS1AP-Antibody-Immunohistochemistry-Paraffin-NBP2-38151-img0004.jpg "Immunohistochemistry-Paraffin: NOS1AP Antibody [NBP2-38151] - Staining of human Cerebral cortex shows very weak cytoplasmic positivity in neuronal cells")
![Immunohistochemistry-Paraffin: NOS1AP Antibody [NBP2-38151] - Staining of human cerebellum shows weak cytoploasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize/NOS1AP-Antibody-Immunohistochemistry-Paraffin-NBP2-38151-img0005.jpg "Immunohistochemistry-Paraffin: NOS1AP Antibody [NBP2-38151] - Staining of human cerebellum shows weak cytoploasmic positivity in purkinje cells.")
![Immunohistochemistry-Paraffin: NOS1AP Antibody [NBP2-38151] - Staining of human breast moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NOS1AP-Antibody-Immunohistochemistry-Paraffin-NBP2-38151-img0006.jpg "Immunohistochemistry-Paraffin: NOS1AP Antibody [NBP2-38151] - Staining of human breast moderate cytoplasmic positivity in glandular cells.")
![Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Flow_Cytometry_3467.jpg)
![Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunocytochemistry_12010.jpg)
![Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunohistochemistry_12592.jpg)
![Western Blot SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD-1_AF7550_Western_Blot_12344.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD1_AF7550_Knockout_Validated_24050.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af7550_human-scd-1-affinity-purified-polyclonal-ab-20820241518560.png)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")