NLRP1/NALP1 Recombinant Protein Antigen

Images

 
There are currently no images for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NLRP1/NALP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP1/NALP1.

Source: E. coli

Amino Acid Sequence: CVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NLRP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57196.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NLRP1/NALP1 Recombinant Protein Antigen

  • CARD7
  • CARD7SLEV1
  • Caspase recruitment domain-containing protein 7
  • CLR17.1
  • Death effector filament-forming ced-4-like apoptosis protein
  • DEFCAP
  • DEFCAPVAMAS1
  • DKFZp586O1822
  • KIAA0926DEFCAP-L/S
  • NACHT, leucine rich repeat and PYD (pyrin domain) containing 1
  • NACHT, leucine rich repeat and PYD containing 1
  • NACHT, LRR and PYD containing protein 1
  • NACHT, LRR and PYD domains-containing protein 1
  • NACPP1044
  • NALP1
  • NALP1caspase recruitment domain protein 7
  • NLR family, pyrin domain containing 1
  • NLRP1
  • Nucleotide-binding domain and caspase recruitment domain
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
  • PP1044
  • SLEV1
  • VAMAS1

Background

NALP1 (also known as NAC/CARD7) is a member of the CATERPILLER (CLR) diverse multigene superfamily of immune regulatory proteins (Ting and Davis, 2005). CLR proteins have a variable N-terminal domain, followed by a nucleotide-binding domain (NBD) and leucine-rich repeats (LRR). The N-terminal domain consists of transactivation, CARD, Pyrin or BIR domains, or in some cases is undefined. The CLR family, also known as the NOD family, has its ancient roots in the plant kingdom and is related to the disease resistance (R) gene family that mediates plant immune responses. CLR proteins participate in both innate and adaptive immunity in mammals, some act as sensors that detect pathogen products, and several CLR genes have been linked to susceptibility to immunological diseases. It is thought that the CLR family may have a fundamental importance for the function of the mammalian innate/ancient immune system on par with the Toll-like receptor (TLR) family. NALP1, a member of NALP CLR subfamily, has an N-terminal pyrin domain (PYD), followed by an NBD, LRR, and a C-terminal CARD domain (reviewed in Tschopp. NALP1 is a component of both the inflammasome and apoptosome, suggesting that NALP1 it has important roles in both inflammation and apoptosis. This antibody recognizes NALP1; human NALP1 is a 1473 amino acid protein and migrates at approx. 166 kDa on SDS-PAGE. However, multiple splice variants encoding distinct NALP1 isoforms with varying amino acid lengths have been described and thus the molecular weight detected may vary depending on the isoform(s) expressed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP2-57196PEP
Species: Hu
Applications: AC

Publications for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP) (0)

There are no publications for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP) (0)

There are no reviews for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NLRP1/NALP1 Products

Research Areas for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP)

Find related products by research area.

Blogs on NLRP1/NALP1.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NLRP1/NALP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP1