Home » NHP2 » NHP2 Proteins » NHP2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NHP2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NHP2 Protein (NBP2-38626PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NHP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NHP2.

Source: E. coli

Amino Acid Sequence: IKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NHP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38626.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NHP2 Recombinant Protein Antigen

  • FLJ20479
  • H/ACA ribonucleoprotein complex subunit 2
  • NHP2 ribonucleoprotein homolog (yeast)
  • NHP2-like protein
  • NHP2P
  • NOLA2member 2 (H/ACA small nucleolar RNPs)
  • Nucleolar protein family A member 2
  • snoRNP protein NHP2

Background

NHP2 is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nhp2p. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOP10 Antibody
NBP2-32441
Immunohistochemistry-Paraffin NOP10 Antibody
Western Blot NOP10 Antibody
Immunocytochemistry/ Immunofluorescence NOP10 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DKC1 Antibody
NBP1-85156
Immunohistochemistry-Paraffin DKC1 Antibody
Western Blot DKC1 Antibody
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
NOLA1 Antibody
NBP2-31742
Immunocytochemistry/ Immunofluorescence NOLA1 Antibody
Immunohistochemistry-Paraffin NOLA1 Antibody
Immunohistochemistry-Paraffin NOLA1 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CNGB1 Antibody
NBP3-12461
Western Blot CNGB1 Antibody
Species: Hu, Rt
Applications: ELISA, IP, WB
TIN2 Antibody
NBP2-55709
Western Blot TIN2 Antibody
Immunocytochemistry/ Immunofluorescence TIN2 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, WB
TERT Antibody (2C4)
NB100-317
Immunohistochemistry-Paraffin TERT Antibody (2C4)
Immunohistochemistry-Paraffin TERT Antibody (2C4)
Flow Cytometry TERT Antibody (2C4)
(26 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
RNPC3 Antibody -
BSA Free
NBP2-93867
Western Blot RNPC3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
NHP2L1 Antibody
NBP1-32732
Western Blot NHP2L1 Antibody
Immunocytochemistry/ Immunofluorescence NHP2L1 Antibody
Immunohistochemistry-Paraffin NHP2L1 Antibody
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, IP, WB
TNIP1 Antibody
NBP1-89306
Western Blot TNIP1 Antibody
Immunohistochemistry-Paraffin TNIP1 Antibody
Immunohistochemistry-Paraffin TNIP1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NOP58 Antibody
NBP1-81680
Western Blot NOP58 Antibody
Western Blot NOP58 Antibody
Immunohistochemistry-Paraffin NOP58 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ACD Antibody
(1D8-1B6)
H00065057-M02
Western Blot ACD Antibody (1D8-1B6)
Immunocytochemistry/ Immunofluorescence ACD Antibody (1D8-1B6)
Immunohistochemistry-Paraffin ACD Antibody (1D8-1B6)
(1 Review)
(8 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
WDR79 Antibody
NB100-68252
Immunohistochemistry-Paraffin WDR79 Antibody
Western Blot WDR79 Antibody
Immunoprecipitation WDR79 Antibody
(1 Review)
(10 Publications)
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KO, WB
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Western Blot PAR1/Thrombin Receptor Antibody (N2-11)
Immunocytochemistry/ Immunofluorescence PAR1/Thrombin Receptor Antibody (N2-11)
Immunohistochemistry PAR1/Thrombin Receptor Antibody (N2-11)
(10 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
RFC2 Antibody
(OTI2B2)
NBP2-45570
Flow Cytometry RFC2 Antibody (OTI2B2)
Immunohistochemistry RFC2 Antibody (OTI2B2)
Immunohistochemistry RFC2 Antibody (OTI2B2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western Blot RFC1 Antibody [Unconjugated]
Species: Hu
Applications: WB
NOLC1 Antibody
NBP3-38210
Immunocytochemistry/ Immunofluorescence NOLC1 Antibody
Western Blot NOLC1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
HVSL1 Antibody
NBP1-97768
Western Blot HVSL1 Antibody
Western Blot HVSL1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NHP2 Recombinant
Protein Antigen
NBP2-38626PEP
NHP2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NHP2 Protein (NBP2-38626PEP) (0)

There are no publications for NHP2 Protein (NBP2-38626PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHP2 Protein (NBP2-38626PEP) (0)

There are no reviews for NHP2 Protein (NBP2-38626PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NHP2 Protein (NBP2-38626PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NHP2 Products

Research Areas for NHP2 Protein (NBP2-38626PEP)

Find related products by research area.

Blogs on NHP2

There are no specific blogs for NHP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: WDR79 Antibody [NB100-68252] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti-WDR79 used at a dilution of 1:200 (1ug/ml). Detection: DAB
WDR79 Antibody
NB100-68252

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NHP2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NHP2