NFkB2/NFkB p100 Antibody (5J6H9) Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NFkB2/NFkB p100 (NP_001070962.1).
Sequence: LRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
NFKB2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
97 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for NFkB2/NFkB p100 Antibody (5J6H9)
Background
The NFkappaB transcription factor was originally identified as a protein complex consisting of a DNA binding subunit and an associated protein. The DNA binding subunit is functionally related to c-Rel p75 and Rel B p68. The p50 subunit was initially believed to be a functionally unique protein derived from the amino-terminus of a precursor designated p105. A cDNA has been isolated that encodes an alternative DNA binding subunit of NFkappaB. It is synthesized as a protein that is expressed in a variety of cell types and, like p105, undergoes cleavage to generate its NFkappaB subunit, in this case a protein designated p52 (previously referred to as p49). In contrast to p50 derived from p105, p52 acts in synergy with p65 to stimulate the HIV enhancer in transiently transfected Jurkat cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Simple Western, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Publications for NFkB2/NFkB p100 Antibody (NBP3-33345) (0)
There are no publications for NFkB2/NFkB p100 Antibody (NBP3-33345).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NFkB2/NFkB p100 Antibody (NBP3-33345) (0)
There are no reviews for NFkB2/NFkB p100 Antibody (NBP3-33345).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NFkB2/NFkB p100 Antibody (NBP3-33345) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NFkB2/NFkB p100 Products
Blogs on NFkB2/NFkB p100