Home » NFkB p105/p50 » NFkB p105/p50 Proteins » NFkB p105/p50 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NFkB p105/p50 Recombinant Protein Antigen

 (1 Publication)
 See All Related
Submit a Review

Images

 
There are currently no images for NFkB p105/p50 Protein (NBP1-87758PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

NFkB p105/p50 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFKB1.

Source: E. coli

Amino Acid Sequence: GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NFKB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87758.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-87758PEP.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NFkB p105/p50 Recombinant Protein Antigen

  • DKFZp686C01211
  • DNA binding factor KBF1
  • DNA-binding factor KBF1
  • EBP-1
  • KBF1
  • NF-kappaB
  • NF-kappa-B
  • NF-kappabeta
  • NFKB-p105
  • NFKB-p50
  • nuclear factor kappa-B DNA binding subunit
  • nuclear factor NF-kappa-B p105 subunit
  • nuclear factor NF-kappa-B p50 subunit
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151
  • p105
  • p50

Background

NFkB is a transcription regulator that is activated by various intra and extra cellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Serine 529 is located in a negatively charged region (amino acids 422-540) that is phosphorylated in response to phorbol myristate acetate plus calcium ionophore activation. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(94 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(1 Publication)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(631 Publications)
Species: Mu
Applications: ELISA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
IkB-alpha Antibody
(6A920) - BSA Free
NB100-56507
Knockout Validated IkB-alpha Antibody (6A920) - BSA Free
Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free
Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free
(41 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(121 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
FosB/G0S3 Antibody
[Unconjugated]
AF2214
Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]
Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]
Species: Hu
Applications: ICC, IHC, WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
JunD Antibody
(512709)
MAB5526
Western Blot JunD Antibody (512709)
(2 Publications)
Species: Hu, Mu
Applications: WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(138 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
c-Rel Antibody
[Unconjugated]
AF2699
Western Blot c-Rel Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) c-Rel Antibody [Unconjugated]
Simple Western c-Rel Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, Simple Western, WB
NFkB p105/p50
Recombinant Protein A ...
NBP1-87758PEP
NFkB p105/p50 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NFkB p105/p50 Protein (NBP1-87758PEP)(1)


Reviews for NFkB p105/p50 Protein (NBP1-87758PEP) (0)

There are no reviews for NFkB p105/p50 Protein (NBP1-87758PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NFkB p105/p50 Protein (NBP1-87758PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFkB p105/p50 Products

Research Areas for NFkB p105/p50 Protein (NBP1-87758PEP)

Find related products by research area.

Blogs on NFkB p105/p50.

Check out the latest blog posts on NFkB p105/p50.
Nuclear Factor kappa B Signaling in the Immune System
Nuclear Factor kappa B (NFkB) binds to the kappa-beta site of the immunoglobulin kappa light chain gene enhancer. Thus NFkB has become one of the widely studied transcription factors in innate and adaptive immune responses. The NFkB family is composed...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
NFkB p105/p50 Antibody (2J10D7) - BSA Free
NB100-56583

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NFkB p105/p50 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NFKB1