![Western Blot: NFIX Antibody [NBP2-58904] - Analysis in human cell line U-138MG.](http://images.novusbio.com/fullsize/NFIX-Antibody-Western-Blot-NBP2-58904-img0009.jpg "Western Blot: NFIX Antibody [NBP2-58904] - Analysis in human cell line U-138MG.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQHSQRQAPPLPTGLSASD |
| Predicted Species | Mouse (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NFIX |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NFIX Antibody (NBP2-58904)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NFIX |
![Immunocytochemistry/Immunofluorescence: NFIX Antibody [NBP2-58904] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NFIX-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58904-img0001.jpg "Immunocytochemistry/Immunofluorescence: NFIX Antibody [NBP2-58904] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-58904] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/NFIX-Antibody-Immunohistochemistry-Paraffin-NBP2-58904-img0008.jpg "Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-58904] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-58904] - Staining of human cerebellum shows strong nuclear positivity in cells in granular layer.](http://images.novusbio.com/fullsize/NFIX-Antibody-Immunohistochemistry-Paraffin-NBP2-58904-img0005.jpg "Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-58904] - Staining of human cerebellum shows strong nuclear positivity in cells in granular layer.")
![Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-58904] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/NFIX-Antibody-Immunohistochemistry-Paraffin-NBP2-58904-img0006.jpg "Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-58904] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-58904] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/NFIX-Antibody-Immunohistochemistry-Paraffin-NBP2-58904-img0007.jpg "Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-58904] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")