Home » NFATC2/NFAT1 » NFATC2/NFAT1 Proteins » NFATC2/NFAT1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NFATC2/NFAT1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NFATC2/NFAT1 Protein (NBP1-82583PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NFATC2/NFAT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFATC2.

Source: E. coli

Amino Acid Sequence: DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NFATC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82583.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NFATC2/NFAT1 Recombinant Protein Antigen

  • NFAT pre-existing subunit
  • NFAT transcription complex, preexisting component
  • NFAT1
  • NFAT1nuclear factor of activated T-cells, cytoplasmic 2
  • NFATC2
  • NF-ATc2
  • NFATP
  • NF-ATp
  • NFATPnuclear factor of activated T-cells, preexisting component
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
  • preexisting nuclear factor of activated T-cells 2
  • T cell transcription factor NFAT1
  • T-cell transcription factor NFAT1

Background

The nuclear factor of activated T-cells (NFAT) transcription complex is required for the expression of a group of proteins that collectively regulate the immune response. Four NFAT proteins, encoded on separate genes and expressed as several splice variants, have been described: NFAT1, NFAT2, NFAT3, and NFAT4. These proteins show a low level of sequence similarity with the Dorsal/Rel/NFkB family of transcription factors. Another NFAT-related protein termed NFAT5 differs from isoforms 1-4 in that it lacks many of the Fos/Jun contact sites observed in its predecessors and its subcellular localization is not calcineurin-dependent.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
NFATC1/NFAT2
Antibody
NB100-56732
Western Blot NFATC1/NFAT2 Antibody
Simple Western NFATC1/NFAT2 Antibody
Western Blot NFATC1/NFAT2 Antibody
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NFATC3/NFAT4
Antibody [Unconjugate
AF5834
Western Blot NFATC3/NFAT4 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FosB/G0S3 Antibody
[Unconjugated]
AF2214
Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]
Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]
Species: Hu
Applications: ICC, IHC, WB
JunD Antibody
(512709)
MAB5526
Western Blot JunD Antibody (512709)
(2 Publications)
Species: Hu, Mu
Applications: WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(149 Publications)
Species: Mu
Applications: ELISA
CD40 Ligand/TNFSF5
[HRP]
DCDL40
N/A CD40 Ligand/TNFSF5 [HRP]
N/A CD40 Ligand/TNFSF5 [HRP]
(44 Publications)
Species: Hu
Applications: ELISA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(454 Publications)
Species: Hu
Applications: BA
CD28 Antibody
(37407) [Unconjugated
MAB342
Agonist Activity CD28 Antibody (37407) [Unconjugated]
Immunocytochemistry CD28 Antibody (37407) [Unconjugated]
(1 Review)
(49 Publications)
Species: Hu
Applications: AgAct, ICC, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
FoxP3 Antibody -
BSA Free
NB100-39002
Flow Cytometry FoxP3 Antibody - BSA Free
Flow Cytometry FoxP3 Antibody - BSA Free
Immunohistochemistry-Paraffin FoxP3 Antibody - BSA Free
(2 Reviews)
(62 Publications)
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NFATC2/NFAT1
Recombinant Protein A ...
NBP1-82583PEP
NFATC2/NFAT1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NFATC2/NFAT1 Protein (NBP1-82583PEP) (0)

There are no publications for NFATC2/NFAT1 Protein (NBP1-82583PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFATC2/NFAT1 Protein (NBP1-82583PEP) (0)

There are no reviews for NFATC2/NFAT1 Protein (NBP1-82583PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NFATC2/NFAT1 Protein (NBP1-82583PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFATC2/NFAT1 Products

Research Areas for NFATC2/NFAT1 Protein (NBP1-82583PEP)

Find related products by research area.

Blogs on NFATC2/NFAT1

There are no specific blogs for NFATC2/NFAT1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NFATC2/NFAT1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NFATC2