Home » NELF-E » NELF-E Proteins » NELF-E Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NELF-E Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NELF-E Recombinant Protein Antigen (NBP2-55487PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

NELF-E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NELF-E.

Source: E. coli

Amino Acid Sequence: VYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVYKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RDBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55487.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NELF-E Recombinant Protein Antigen

  • D6S45
  • negative elongation factor E
  • negative elongation factor polypeptide E
  • NELFE
  • NELF-ERDmajor histocompatibility complex gene RD
  • nuclear protein
  • RD RNA binding protein
  • RD RNA-binding protein
  • RDP
  • RNA-binding protein RD

Background

NELF-E is encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(4 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Regucalcin Antibody
NBP1-80849
Western Blot Regucalcin Antibody
Immunohistochemistry-Paraffin Regucalcin Antibody
Immunohistochemistry-Paraffin Regucalcin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NNT Antibody
NBP1-32109
Immunocytochemistry/ Immunofluorescence NNT Antibody
Western Blot NNT Antibody
Western Blot NNT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot KRAS Antibody (3B10-2F2)
Western Blot KRAS Antibody (3B10-2F2)
Western Blot KRAS Antibody (3B10-2F2)
(1 Review)
(17 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Nucleostemin
Antibody [Unconjugate
AF1638
Immunocytochemistry Nucleostemin Antibody [Unconjugated]
Simple Western Nucleostemin Antibody [Unconjugated]
Western Blot Nucleostemin Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
p130 Antibody
NBP1-82455
Immunohistochemistry-Paraffin p130 Antibody
Immunohistochemistry-Paraffin p130 Antibody
Immunohistochemistry-Paraffin p130 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FACA/FANCA Antibody
NB100-2564
Western Blot FACA/FANCA Antibody
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry Frataxin Antibody (OTI1C12)
Western Blot Frataxin Antibody (OTI1C12)
Immunohistochemistry-Paraffin Frataxin Antibody (OTI1C12)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]
Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
CDAN1 Antibody
NBP2-38473
Immunocytochemistry/ Immunofluorescence CDAN1 Antibody
Western Blot CDAN1 Antibody
Immunohistochemistry-Paraffin CDAN1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(631 Publications)
Species: Mu
Applications: ELISA
MID1 Antibody -
BSA Free
NBP3-05061
Immunocytochemistry/ Immunofluorescence MID1 Antibody - BSA Free
Western Blot MID1 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for NELF-E Recombinant Protein Antigen (NBP2-55487PEP) (0)

There are no publications for NELF-E Recombinant Protein Antigen (NBP2-55487PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NELF-E Recombinant Protein Antigen (NBP2-55487PEP) (0)

There are no reviews for NELF-E Recombinant Protein Antigen (NBP2-55487PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NELF-E Recombinant Protein Antigen (NBP2-55487PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NELF-E Products

Array NBP2-55487PEP

Research Areas for NELF-E Recombinant Protein Antigen (NBP2-55487PEP)

Find related products by research area.

Blogs on NELF-E

There are no specific blogs for NELF-E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NELF-E Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RDBP