![Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining in human fallopian tube and skeletal muscle tissues using NBP2-38473 antibody. Corresponding CDAN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CDAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38473-img0013.jpg "Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining in human fallopian tube and skeletal muscle tissues using NBP2-38473 antibody. Corresponding CDAN1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDAN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CDAN1 Antibody (NBP2-38473)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: CDAN1 Antibody [NBP2-38473] - Analysis in control (vector only transfected HEK293T lysate) and CDAN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/CDAN1-Antibody-Western-Blot-NBP2-38473-img0008.jpg "Western Blot: CDAN1 Antibody [NBP2-38473] - Analysis in control (vector only transfected HEK293T lysate) and CDAN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: CDAN1 Antibody [NBP2-38473] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CDAN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38473-img0004.jpg "Immunocytochemistry/Immunofluorescence: CDAN1 Antibody [NBP2-38473] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/CDAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38473-img0009.jpg "Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human prostate shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/CDAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38473-img0010.jpg "Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human prostate shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CDAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38473-img0011.jpg "Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human skin shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CDAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38473-img0012.jpg "Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human skin shows moderate cytoplasmic positivity in glandular cells.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Neutralization G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images2/G-CSF_MAB414_Block_Neutralize_9188.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")