Nectin-2/CD112 Recombinant Protein Antigen

Name: Nectin-2/CD112 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-91211PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for Nectin-2/CD112 Protein (NBP1-91211PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

Nectin-2/CD112 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PVRL2. Source: E. coli Amino Acid Sequence: VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	NECTIN2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91211. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nectin-2/CD112 Recombinant Protein Antigen

CD112 antigen
CD112
Herpes virus entry mediator B
Herpesvirus entry mediator B
herpesvirus entry protein B
HVEB
HVEBpoliovirus receptor-like 2
MPH
nectin 2
Nectin2
Nectin-2
poliovirus receptor-related 2 (herpesvirus entry mediator B)
poliovirus receptor-related protein 2
PRR2
PRR2nectin-2
PVRL2
PVRR2poliovirus receptor related 2

Background

Nectin 2 encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD155/PVR Antibody
(300907) [Unconjugate ...

MAB25301

Immunocytochemistry CD155/PVR Antibody (300907) [Unconjugated]

(1 Review)

(9 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, WB

DNAM-1/CD226
Antibody (102511) [Un ...

MAB666

Neutralization DNAM-1/CD226 Antibody (102511) [Unconjugated]

(1 Review)

(10 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, Neut, WB

Nectin-1/PVRL1
Antibody

AF2880

(2 Publications)

Species: Hu, Mu

Applications: WB

HVEM/TNFRSF14
Antibody (94801) [Unc ...

MAB356

Block/ Neutralize HVEM/TNFRSF14 Antibody (94801) [Unconjugated]

(1 Review)

(4 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB

NKG2D/CD314
Antibody (149810) [Un ...

MAB139

(1 Review)

(101 Publications)

Species: Hu

Applications: CostimT, CyTOF-ready, Flow, Neut, WB

Apolipoprotein
E/ApoE Antibody (WUE- ...

NB110-60531

Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free

Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free

(2 Reviews)

(41 Publications)

Species: Hu, Mu, Rt(-)

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB

Nectin-3/PVRL3
Antibody [Unconjugate

AF3064

(3 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, IHC, WB

IL-2 R beta
Antibody (27302)

MAB224

Neutralization IL-2 R beta Antibody (27302)

(7 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, IHC, Neut

DARC Antibody
[Unconjugated]

AF6695

Western Blot DARC Antibody [Unconjugated]

Flow Cytometry DARC Antibody [Unconjugated]

(1 Publication)

Species: Mu, Rt

Applications: CyTOF-ready, Flow, IHC, WB

Afadin/AF-6
Antibody [Unconjugate

AF7829

Immunohistochemistry Afadin/AF-6 Antibody [Unconjugated]

Immunocytochemistry Afadin/AF-6 Antibody [Unconjugated]

(1 Publication)

Species: Hu

Applications: ICC, IHC, WB

CTLA-4
[Unconjugated]

7268-CT

(3 Publications)

Species: Hu

Applications: BA

IGSF4A/SynCAM1/CADM1 A

NB300-186

Western Blot IGSF4A/SynCAM1/CADM1 Antibody

Immunocytochemistry/ Immunofluorescence IGSF4A/SynCAM1/CADM1 Antibody

(2 Publications)

Species: Hu, Rt

Applications: ICC/IF, Simple Western, WB

Integrin beta
2/CD18 Antibody [Unco ...

AF1730

Flow Cytometry Integrin beta 2/CD18 Antibody [Unconjugated]

(16 Publications)

Species: Hu

Applications: AdBlk, CyTOF-ready, Flow, ICC

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...

NBP2-79843

Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

NKp30/NCR3
[Unconjugated]

1849-NK

(19 Publications)

Species: Hu

Applications: BA

Integrin alpha
L/CD11a Antibody (345 ...

MAB3595

Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, Simple Western, WB

NKp46/NCR1
Antibody [Unconjugate

AF2225

Immunohistochemistry NKp46/NCR1 Antibody [Unconjugated]

Flow Cytometry NKp46/NCR1 Antibody [Unconjugated]

(1 Review)

(66 Publications)

Species: Mu

Applications: AgAct, CyTOF-ready, Flow, IHC, WB

Publications for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

There are no publications for Nectin-2/CD112 Protein (NBP1-91211PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

There are no reviews for Nectin-2/CD112 Protein (NBP1-91211PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nectin-2/CD112 Products

Research Areas for Nectin-2/CD112 Protein (NBP1-91211PEP)

Find related products by research area.

Immunology

Blogs on Nectin-2/CD112

There are no specific blogs for Nectin-2/CD112, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Human peripheral blood mononuclear cells (PBMCs) gated on CD3- cells were stained with Mouse Anti-Human NCAM-1/CD56 APC-conjugated Monoclonal Antibody (Catalog # FAB2408A) and either (A) Mouse Anti-Human NKG2D/CD314 Monoclonal Antibody (Catalog # MAB139) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by anti-Mouse IgG PE-conjugated Monoclonal Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.

NKG2D/CD314 Antibody (149810) [Unconjugated]
MAB139-100

Mouse NKp46/NCR1 Antigen Affinity-purified Polyclonal Antibody induces IFN-gamma secretion in mouse natural killer (NK) cells activated with 25 ng/mL Recombinant Mouse IL-2 (Catalog # 402-ML) and 25 ng/mL Recombinant Mouse IL-12 (Catalog # 419-ML), in a dose-dependent manner, as measured using the Quantikine Mouse IFN-gamma ELISA Kit (Catalog # MIF00). The ED50 for this effect is typically0.4-2.4 μg/mL.

NKp46/NCR1 Antibody [Unconjugated]
AF2225

Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.

Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
NB110-60531

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Nectin-2/CD112 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

NECTIN2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Nectin-2/CD112 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Nectin-2/CD112 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Nectin-2/CD112 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

Reviews for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

FAQs for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

Additional Nectin-2/CD112 Products

Research Areas for Nectin-2/CD112 Protein (NBP1-91211PEP)

Blogs on Nectin-2/CD112

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics