![Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Western blot analysis of extracts of various cell lines, using NDUFB8 Rabbit mAb (NBP3-15882) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/NDUFB8-Antibody-6T8G1-Western-Blot-NBP3-15882-img0005.jpg "Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Western blot analysis of extracts of various cell lines, using NDUFB8 Rabbit mAb (NBP3-15882) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 6T8G1 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFB8 (O95169). MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVY |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | NDUFB8 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NDUFB8 Antibody (NBP3-15882)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDUFB8 |
![Immunocytochemistry/Immunofluorescence: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Immunofluorescence analysis of U-2 OS cells using NDUFB8 Rabbit mAb (NBP3-15882) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NDUFB8-Antibody-6T8G1-Immunocytochemistry-Immunofluorescence-NBP3-15882-img0004.jpg "Immunocytochemistry/Immunofluorescence: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Immunofluorescence analysis of U-2 OS cells using NDUFB8 Rabbit mAb (NBP3-15882) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Immunohistochemistry of paraffin-embedded mouse kidney using NDUFB8 Rabbit mAb (NBP3-15882) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NDUFB8-Antibody-6T8G1-Immunohistochemistry-Paraffin-NBP3-15882-img0003.jpg "Immunohistochemistry-Paraffin: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Immunohistochemistry of paraffin-embedded mouse kidney using NDUFB8 Rabbit mAb (NBP3-15882) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Western blot analysis of extracts of various cell lines, using NDUFB8 Rabbit mAb (NBP3-15882) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/NDUFB8-Antibody-6T8G1-Western-Blot-NBP3-15882-img0006.jpg "Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Western blot analysis of extracts of various cell lines, using NDUFB8 Rabbit mAb (NBP3-15882) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Immunohistochemistry-Paraffin: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Immunohistochemistry of paraffin-embedded rat heart using NDUFB8 Rabbit mAb (NBP3-15882) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NDUFB8-Antibody-6T8G1-Immunohistochemistry-Paraffin-NBP3-15882-img0001.jpg "Immunohistochemistry-Paraffin: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Immunohistochemistry of paraffin-embedded rat heart using NDUFB8 Rabbit mAb (NBP3-15882) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Immunohistochemistry of paraffin-embedded human esophageal cancer using NDUFB8 Rabbit mAb (NBP3-15882) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NDUFB8-Antibody-6T8G1-Immunohistochemistry-Paraffin-NBP3-15882-img0002.jpg "Immunohistochemistry-Paraffin: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Immunohistochemistry of paraffin-embedded human esophageal cancer using NDUFB8 Rabbit mAb (NBP3-15882) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15882_rabbit-ndufb8-mab-6t8g1-52202517273542.jpg "Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human colon using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15882_rabbit-ndufb8-mab-6t8g1-5220251725192.jpg "Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human colon using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Rat liver using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15882_rabbit-ndufb8-mab-6t8g1-52202517152726.jpg "Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Rat liver using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15882_rabbit-ndufb8-mab-6t8g1-52202517223964.jpg "Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody (6T8G1) [NDUFB8] - Confocal imaging of paraffin-embedded Mouse brain using NDUFB8 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-15882_rabbit-ndufb8-mab-6t8g1-52202517284938.jpg "Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody (6T8G1) [NDUFB8] - Confocal imaging of paraffin-embedded Mouse brain using NDUFB8 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15882_rabbit-ndufb8-mab-6t8g1-5220251726074.jpg "Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human kidney using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15882_rabbit-ndufb8-mab-6t8g1-5220251718977.jpg "Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human kidney using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15882_rabbit-ndufb8-mab-6t8g1-52202517184596.jpg "Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")