![Western Blot: CAP1 Antibody [NBP1-86644] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/CAP1-Antibody-Western-Blot-NBP1-86644-img0005.jpg "Western Blot: CAP1 Antibody [NBP1-86644] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CAP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
| Publication using NBP1-86644 | Applications | Species |
|---|---|---|
| Wu, X, Wang, Y Et al. Molecular expression and functional analysis of genes in children with temporal lobe epilepsy. J Integr Neurosci 2019-03-30 [PMID: 31091851] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for CAP1 Antibody (NBP1-86644)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CAP1 |
![Immunocytochemistry/Immunofluorescence: CAP1 Antibody [NBP1-86644] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/CAP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86644-img0006.jpg "Immunocytochemistry/Immunofluorescence: CAP1 Antibody [NBP1-86644] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human tonsil shows moderate cytoplasmic/ membranous positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/CAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86644-img0011.jpg "Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human tonsil shows moderate cytoplasmic/ membranous positivity in non-germinal center cells.")
![Western Blot: CAP1 Antibody [NBP1-86644] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/CAP1-Antibody-Western-Blot-NBP1-86644-img0004.jpg "Western Blot: CAP1 Antibody [NBP1-86644] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells outside the reaction centres and moderate to strong cytoplasmic and membranous positivity in the lining epithelium.](http://images.novusbio.com/fullsize/CAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86644-img0007.jpg "Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells outside the reaction centres and moderate to strong cytoplasmic and membranous positivity in the lining epithelium.")
![Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86644-img0008.jpg "Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human prostate shows moderate cytoplasmic/ membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/CAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86644-img0009.jpg "Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human prostate shows moderate cytoplasmic/ membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86644-img0010.jpg "Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot SGPL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SGPL1_AF5535_Western_Blot_5750.jpg)
![Simple Western SGPL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SGPL1_AF5535_Simple_Western_17128.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")