NDUFAF5 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Mouse NDUFAF5. Peptide sequence: DTMLAAAAVYREMYRNEDGSIPATFQIYHMIGWKYHDSQARPAERGSAT The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NDUFAF5 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for NDUFAF5 Antibody
Background
The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer ofelectrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the innermitochondrial membrane. This gene encodes a mitochondrial protein that is associated with the matrix face of themitochondrial inner membrane and is required for complex I assembly. A mutation in this gene results in mitochondrialcomplex I deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.(provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Mu
Applications: WB
Publications for NDUFAF5 Antibody (NBP2-87892) (0)
There are no publications for NDUFAF5 Antibody (NBP2-87892).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NDUFAF5 Antibody (NBP2-87892) (0)
There are no reviews for NDUFAF5 Antibody (NBP2-87892).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NDUFAF5 Antibody (NBP2-87892) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NDUFAF5 Products
Blogs on NDUFAF5