![Western Blot: NDUFAF3 Antibody [NBP1-89382] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Western-Blot-NBP1-89382-img0006.jpg "Western Blot: NDUFAF3 Antibody [NBP1-89382] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NDUFAF3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDUFAF3 |
![Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89382-img0016.jpg "Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: NDUFAF3 Antibody [NBP1-89382] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Western-Blot-NBP1-89382-img0005.jpg "Western Blot: NDUFAF3 Antibody [NBP1-89382] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human kidney.](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89382-img0008.jpg "Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human urinary bladder.](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89382-img0009.jpg "Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human urinary bladder.")
![Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human colon.](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89382-img0010.jpg "Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human colon.")
![Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human testis.](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89382-img0011.jpg "Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human testis.")
![Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human fallopian tube, kidney, prostate and testis using Anti-NDUFAF3 antibody NBP1-89382 (A) shows similar protein distribution across tissues to independent antibody NBP2-48638 (B).](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89382-img0012.jpg "Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human fallopian tube, kidney, prostate and testis using Anti-NDUFAF3 antibody NBP1-89382 (A) shows similar protein distribution across tissues to independent antibody NBP2-48638 (B).")
![Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89382-img0013.jpg "Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89382-img0014.jpg "Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry: NDUFAF3 Antibody [NBP1-89382] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NDUFAF3-Antibody-Immunohistochemistry-NBP1-89382-img0015.jpg "Immunohistochemistry: NDUFAF3 Antibody [NBP1-89382] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Immunocytochemistry__Immunofluorescence_21057.jpg)
![Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Simple_Western_16621.jpg)
![Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Western_Blot_12767.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")