Home » NARG1 » NARG1 Proteins » NARG1 Recombinant Protein Antigen

NARG1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NARG1 Protein (NBP1-92165PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

NARG1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAA15.

Source: E. coli

Amino Acid Sequence: ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NAA15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92165.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NARG1 Recombinant Protein Antigen

  • FLJ13340
  • GA19
  • Gastric cancer antigen Ga19
  • N(alpha)-acetyltransferase 15, NatA auxiliary subunit
  • NARG1
  • NATHGa19
  • NMDA receptor-regulated protein 1
  • N-terminal acetyltransferase
  • Protein tubedown-1
  • Tbdn100
  • TBDN100NatA auxiliary subunit
  • transcriptional coactivator tubedown-100
  • tubedown-1

Background

NARG1 (NMDA receptor-regulated 1) is also known as NATH (N-acetyltransferase). The NARG1 gene, along with NARG2 and NARG3, was originally identified as a gene regulated by NMDA receptors in developing neurons. The NARG1 gene was found to be a homolog of a yeast N-terminal acetyltransferase that functions in control of the G(0) phase of the cell cycle. NARG1 was also identified as NATH in experiments set out to identify genes differentially expressed in papillary thyroid carcinoma (PTC). The NATH protein has been shown to form a complex with human ARD1 where they function as an acetyltransferase and interact with ribosomal subunits. The ARD1/NATH complex plays an important role in cell survival. Alternative names for NARG1 include protein tubedown-1, Tbdn100, gastric cancer antigen Ga19, and GA19.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NAA10 Antibody
NBP2-19461
Western Blot NAA10 Antibody
Immunohistochemistry-Paraffin NAA10 Antibody
Immunocytochemistry/ Immunofluorescence NAA10 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NIPP1 Antibody
NBP1-90113
Western Blot NIPP1 Antibody
Immunohistochemistry-Paraffin NIPP1 Antibody
Western Blot NIPP1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
TRIM23 Antibody
NB100-78620
Immunohistochemistry-Paraffin TRIM23 Antibody
Western Blot TRIM23 Antibody
Immunocytochemistry/ Immunofluorescence TRIM23 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot GLS2 Antibody - BSA Free
Immunohistochemistry GLS2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GLS2 Antibody - BSA Free
(7 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin AGA Antibody
Immunohistochemistry-Paraffin AGA Antibody
Immunohistochemistry-Paraffin AGA Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin BRD2 Antibody
Immunocytochemistry/ Immunofluorescence BRD2 Antibody
Immunoprecipitation BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NAT13 Antibody -
BSA Free
NBP2-93356
Immunocytochemistry/ Immunofluorescence NAT13 Antibody - BSA Free
Immunohistochemistry-Paraffin NAT13 Antibody - BSA Free
Immunohistochemistry-Paraffin NAT13 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NAT1 Antibody
(SR4177)
NBP3-27820
Western Blot NAT1 Antibody (SR4177)
Species: Hu
Applications: Flow, ICC/IF, WB
SLC38A6 Antibody
NBP1-81010
Immunocytochemistry/ Immunofluorescence SLC38A6 Antibody
Immunohistochemistry-Paraffin SLC38A6 Antibody
Immunohistochemistry-Paraffin SLC38A6 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
SLC38A3 Antibody
NBP1-60103
Immunohistochemistry SLC38A3 Antibody
Immunohistochemistry SLC38A3 Antibody
Western Blot SLC38A3 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB

SLC6A2/NET/Noradrenali ...
NBP3-12251
Western Blot SLC6A2/NET/Noradrenaline transporter Antibody
Immunohistochemistry-Paraffin SLC6A2/NET/Noradrenaline transporter Antibody
Immunohistochemistry-Paraffin SLC6A2/NET/Noradrenaline transporter Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
(45 Reviews)
(1055 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
DAP5 Antibody
NBP1-85311
Western Blot DAP5 Antibody
Western Blot DAP5 Antibody
Immunohistochemistry-Paraffin DAP5 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
RUNX2/CBFA1
Antibody (232902) [Un ...
MAB2006
Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]
Immunohistochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: ICC
NARG2 Antibody
H00079664-B01P
Western Blot NARG2 Antibody
Immunocytochemistry/ Immunofluorescence NARG2 Antibody
Species: Hu
Applications: ICC/IF, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(559 Publications)
Species: Hu
Applications: BA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(48 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

Publications for NARG1 Protein (NBP1-92165PEP) (0)

There are no publications for NARG1 Protein (NBP1-92165PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NARG1 Protein (NBP1-92165PEP) (0)

There are no reviews for NARG1 Protein (NBP1-92165PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NARG1 Protein (NBP1-92165PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NARG1 Products

Array NBP1-92165PEP

Research Areas for NARG1 Protein (NBP1-92165PEP)

Find related products by research area.

Blogs on NARG1

There are no specific blogs for NARG1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
HIF-1 alpha Antibody (H1alpha67)
NB100-105

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NARG1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NAA15